SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70607178|ref|YP_256048.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70607178|ref|YP_256048.1|
Domain Number 1 Region: 8-430
Classification Level Classification E-value
Superfamily ADC synthase 3.01e-139
Family ADC synthase 0.0000000000766
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|70607178|ref|YP_256048.1|
Sequence length 432
Comment anthranilate synthase component I [Sulfolobus acidocaldarius DSM 639]
Sequence
MEVYPITAFTQPNEVFSCIKKDEDVAVLLESGSGPQYKSRYSMIGWGRKGYISLYKNKSS
GDIVKEFYDPIEVLSEFLNKAPSLNVPGKFKGGIFGYMGYDGVRYWETIKDLKPEPEKWP
YAEFFIPQNIIVYDHAEGKVYLDGDLPTKYNCISSDETKFSYYEESLKKEEFEGIVKEAL
DYIRRGYIFQVVLSRFYKYIYKGDLMRFYNNLRKVNPSPYMFYMKFMDREIIGSSPETLF
SVQGGVVETYPIAGSRPRGRTLEEDLELERDLLSSEKERAEHLMLVDLARNDIGKVCYMG
SVKVPEFMYVEKYAYVQHIVSKVVGTLRKNLTSFDVLKSTFPAGTVSGAPKPMAMNLIEL
FEHYKRGPYAGGVGFFSSNGDAEFAITIRSAFVNKDTIRIQAGAGIVYDSVPEMEYFETE
HKMRALKVAMGV
Download sequence
Identical sequences A0A0U2NC45 M1IVZ2 M1IYS8 Q4J8X5
gi|449067417|ref|YP_007434499.1| WP_011278257.1.100797 WP_011278257.1.13097 WP_011278257.1.15291 WP_011278257.1.18585 WP_011278257.1.18739 WP_011278257.1.19907 WP_011278257.1.20267 WP_011278257.1.24072 WP_011278257.1.28054 WP_011278257.1.29213 WP_011278257.1.30898 WP_011278257.1.31299 WP_011278257.1.3283 WP_011278257.1.33024 WP_011278257.1.33782 WP_011278257.1.34459 WP_011278257.1.34536 WP_011278257.1.35781 WP_011278257.1.35800 WP_011278257.1.36276 WP_011278257.1.37881 WP_011278257.1.38112 WP_011278257.1.38253 WP_011278257.1.39308 WP_011278257.1.39398 WP_011278257.1.43265 WP_011278257.1.4394 WP_011278257.1.45682 WP_011278257.1.48356 WP_011278257.1.49892 WP_011278257.1.50721 WP_011278257.1.51246 WP_011278257.1.5150 WP_011278257.1.53520 WP_011278257.1.55288 WP_011278257.1.55517 WP_011278257.1.56706 WP_011278257.1.57256 WP_011278257.1.64117 WP_011278257.1.64360 WP_011278257.1.67449 WP_011278257.1.68798 WP_011278257.1.7301 WP_011278257.1.74875 WP_011278257.1.78046 WP_011278257.1.78998 WP_011278257.1.8042 WP_011278257.1.83345 WP_011278257.1.87279 WP_011278257.1.90653 WP_011278257.1.90680 WP_011278257.1.95134 WP_011278257.1.96274 WP_011278257.1.97501 330779.Saci_1425 gi|70607178|ref|YP_256048.1| gi|449069689|ref|YP_007436770.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]