SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70607188|ref|YP_256058.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70607188|ref|YP_256058.1|
Domain Number 1 Region: 144-485,514-590
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.43e-129
Family Amylase, catalytic domain 0.000000221
Further Details:      
 
Domain Number 2 Region: 8-156
Classification Level Classification E-value
Superfamily E set domains 2.24e-44
Family E-set domains of sugar-utilizing enzymes 0.0018
Further Details:      
 
Domain Number 3 Region: 604-708
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000000316
Family alpha-Amylases, C-terminal beta-sheet domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|70607188|ref|YP_256058.1|
Sequence length 713
Comment amylase [Sulfolobus acidocaldarius DSM 639]
Sequence
MKDRPLKPGEPYPLGATWIEEEDGVNFVLFSENATKVELLTYSQTRQDEPKEIIELRQRT
GDLWHVFVPGLRPGQLYGYRVYGPYKPEEGLRFNPNKVLIDPYAKAINGLLLWDDSVFGY
KIGDQNQDLSFDERKDDKFIPKGVIINPYFDWEDEHFFFRRKIPFKDSIIYETHIKGITK
LRQDLPENVRGTFLGLASDTMIDYLKDLGITTVEIMPIQQFVDERFIVDKGLKNYWGYNP
INYFSPECRYSSSGCLGNQVIEFKKLVNSLHNAGLEVIIDVVYNHTAEGNHLGPTLSFKG
IDNSSYYMLDPKNKRYYIDFTGTGNTLNLSHPRVLQLVLDSLRYWVLEMHVDGFRFDLAS
ALARQLYSVNMLSTFFVAIQQDPILSQVKLIAEPWDVGPGGYQVGNFPYLWAEWNGKYRD
TIRRFWRGDPVPYEELANRLLGSPDLYAGSNKTPFASINYITSHDGFTLQDLVSYNQKHN
EANKLNNEDGMNENYSWNCGVEGETNDSNILYCREKQRRNFVITLFVSQGIPMILGGDEI
GRTQKGNNNAFCQDNETSWYDWNLDENRVRFHDFVRRLTNFYKAHPIFRRARYFQGKKLH
GSPLKDVTWLKPDGNEVDDSVWKSPTNHIIYILEGSAIDEINYNGERIADDTFLIILNGA
STNLKIKVPHGKWELVLHPYPHEPSNDKKIIENNKEVEIDGKTALIYRRIEFQ
Download sequence
Identical sequences F2Z6B6 M1IDF6 M1IRK3 O05152
330779.Saci_1439 WP_011278267.1.100797 WP_011278267.1.13097 WP_011278267.1.15291 WP_011278267.1.18585 WP_011278267.1.18739 WP_011278267.1.19907 WP_011278267.1.20267 WP_011278267.1.24072 WP_011278267.1.28054 WP_011278267.1.29213 WP_011278267.1.30898 WP_011278267.1.31299 WP_011278267.1.3283 WP_011278267.1.33024 WP_011278267.1.33782 WP_011278267.1.34459 WP_011278267.1.34536 WP_011278267.1.35781 WP_011278267.1.35800 WP_011278267.1.36276 WP_011278267.1.37881 WP_011278267.1.38112 WP_011278267.1.38253 WP_011278267.1.39308 WP_011278267.1.39398 WP_011278267.1.43265 WP_011278267.1.4394 WP_011278267.1.45682 WP_011278267.1.48356 WP_011278267.1.49892 WP_011278267.1.50721 WP_011278267.1.51246 WP_011278267.1.5150 WP_011278267.1.53520 WP_011278267.1.55288 WP_011278267.1.55517 WP_011278267.1.56706 WP_011278267.1.57256 WP_011278267.1.64117 WP_011278267.1.64360 WP_011278267.1.67449 WP_011278267.1.68798 WP_011278267.1.7301 WP_011278267.1.74875 WP_011278267.1.78046 WP_011278267.1.78998 WP_011278267.1.8042 WP_011278267.1.83345 WP_011278267.1.87279 WP_011278267.1.90653 WP_011278267.1.90680 WP_011278267.1.95134 WP_011278267.1.96274 WP_011278267.1.97501 NYSGRC-FDAO-70607188 gi|449067428|ref|YP_007434510.1| gi|449069700|ref|YP_007436781.1| gi|70607188|ref|YP_256058.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]