SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70607189|ref|YP_256059.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70607189|ref|YP_256059.1|
Domain Number 1 Region: 98-486
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.43e-99
Family Amylase, catalytic domain 0.0000000000797
Further Details:      
 
Domain Number 2 Region: 4-89
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000262
Family E-set domains of sugar-utilizing enzymes 0.00039
Further Details:      
 
Weak hits

Sequence:  gi|70607189|ref|YP_256059.1|
Domain Number - Region: 489-554
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00273
Family alpha-Amylases, C-terminal beta-sheet domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|70607189|ref|YP_256059.1|
Sequence length 556
Comment maltooligosyl trehalose trehalohydrolase [Sulfolobus acidocaldarius DSM 639]
Sequence
MFSFGGNIEKNKGIFKLWAPYVNSVKLKLSKKLIPMEKNDEGFFEVEIDDIEENLTYSYI
IEDKREIPDPASRYQPLGVHDKSQLIRTDYQILDLGKVKIEDLIIYELHVGTFSQEGNFK
GVIEKLDYLKDLGITGIELMPVAQFPGNRDWGYDGVFLYAVQNTYGGPWELAKLVNEAHK
RGIAVILDVVYNHIGPEGNYLLGLGPYFSDRYKTPWGLTFNFDDRGCDQVRKFILENVEY
WFKTFKIDGLRLDAVHAIFDNSPKHILQEIAEKAHQLGKFVIAESDLNDPKIVKDDCGYK
IDAQWVDDFHHAVHAFITKEKDYYYQDFGRIEDIEKTFKDVFVYDGKYSRYRGRTHGAPV
GDLPPRKFVVFIQNHDQVGNRGNGERLSILTDKTTYLMAATLYILSPYIPLIFMGEEYYE
TNPFFFFSDFSDPVLIKGVREGRLKENNQMIDPQSEEAFLKSKLSWKIDEEVLDYYKQLI
NIRKRYNNCKRVKEVRREGNCITLIMEKIGIIASFDDIVINSKITGNLLIGIGFPKKLKK
DELIKVNRGVGVYQLE
Download sequence
Identical sequences F2Z6C5 M1I5I9 M1J2I1 Q53641
330779.Saci_1440 WP_011278268.1.100797 WP_011278268.1.13097 WP_011278268.1.15291 WP_011278268.1.18585 WP_011278268.1.18739 WP_011278268.1.19907 WP_011278268.1.20267 WP_011278268.1.24072 WP_011278268.1.28054 WP_011278268.1.29213 WP_011278268.1.30898 WP_011278268.1.31299 WP_011278268.1.3283 WP_011278268.1.33024 WP_011278268.1.33782 WP_011278268.1.34459 WP_011278268.1.34536 WP_011278268.1.35781 WP_011278268.1.35800 WP_011278268.1.36276 WP_011278268.1.37881 WP_011278268.1.38112 WP_011278268.1.38253 WP_011278268.1.39308 WP_011278268.1.39398 WP_011278268.1.43265 WP_011278268.1.4394 WP_011278268.1.45682 WP_011278268.1.48356 WP_011278268.1.49892 WP_011278268.1.50721 WP_011278268.1.51246 WP_011278268.1.5150 WP_011278268.1.53520 WP_011278268.1.55288 WP_011278268.1.55517 WP_011278268.1.56706 WP_011278268.1.57256 WP_011278268.1.64117 WP_011278268.1.64360 WP_011278268.1.67449 WP_011278268.1.68798 WP_011278268.1.7301 WP_011278268.1.74875 WP_011278268.1.78046 WP_011278268.1.78998 WP_011278268.1.8042 WP_011278268.1.83345 WP_011278268.1.87279 WP_011278268.1.90653 WP_011278268.1.90680 WP_011278268.1.95134 WP_011278268.1.96274 WP_011278268.1.97501 gi|449069701|ref|YP_007436782.1| gi|70607189|ref|YP_256059.1| gi|449067429|ref|YP_007434511.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]