SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70607224|ref|YP_256094.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70607224|ref|YP_256094.1|
Domain Number 1 Region: 118-358
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.01e-69
Family Creatinase/aminopeptidase 0.0000015
Further Details:      
 
Domain Number 2 Region: 2-135
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 0.00000000000000349
Family Creatinase/prolidase N-terminal domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|70607224|ref|YP_256094.1|
Sequence length 365
Comment Xaa-Pro dipeptidase [Sulfolobus acidocaldarius DSM 639]
Sequence
MRLQKLDRILEERDVKNAIIIGGANIFYLTGYDYISTDFANAVALIYNDSVPILVVPVLE
KNRAQSKVGDKIEVVAYSSYQVSDDVIRGSLVDIISKYIEANRRIAIDMLYSGSMFYLSL
SKKISSENLVDVSKDFYIIRAKKEPEELELIKKAGDITSSAMKISSEKIHEEYVSEKQLA
GLIDMTMRNEGAEEYAFSSIVAFAENSAFPHHIPTDRVIKNGENAVIDIGARYNNYCFDS
TRTFVKSNNDEVKKVYEIVLQAQEEAIDAVRDGTRASEIDRIARNVIEKAGYGKYFVHST
GHGVGIEIHEYPSISLSSDAILEEDMVITVEPGIYLKGKFGIRIEDTIIVTKKKPIVLET
IYKYL
Download sequence
Identical sequences A0A0U3FUS5 M1J388 M1J685 Q4J8S7
330779.Saci_1480 WP_011278303.1.100797 WP_011278303.1.13097 WP_011278303.1.15291 WP_011278303.1.18585 WP_011278303.1.18739 WP_011278303.1.19907 WP_011278303.1.20267 WP_011278303.1.24072 WP_011278303.1.28054 WP_011278303.1.29213 WP_011278303.1.30898 WP_011278303.1.31299 WP_011278303.1.3283 WP_011278303.1.33024 WP_011278303.1.33782 WP_011278303.1.34459 WP_011278303.1.34536 WP_011278303.1.35781 WP_011278303.1.35800 WP_011278303.1.36276 WP_011278303.1.37881 WP_011278303.1.38112 WP_011278303.1.38253 WP_011278303.1.39308 WP_011278303.1.39398 WP_011278303.1.43265 WP_011278303.1.4394 WP_011278303.1.45682 WP_011278303.1.48356 WP_011278303.1.49892 WP_011278303.1.50721 WP_011278303.1.51246 WP_011278303.1.5150 WP_011278303.1.53520 WP_011278303.1.55288 WP_011278303.1.55517 WP_011278303.1.56706 WP_011278303.1.57256 WP_011278303.1.64117 WP_011278303.1.64360 WP_011278303.1.67449 WP_011278303.1.68798 WP_011278303.1.7301 WP_011278303.1.74875 WP_011278303.1.78046 WP_011278303.1.78998 WP_011278303.1.8042 WP_011278303.1.83345 WP_011278303.1.87279 WP_011278303.1.90653 WP_011278303.1.90680 WP_011278303.1.95134 WP_011278303.1.96274 WP_011278303.1.97501 gi|449067466|ref|YP_007434548.1| gi|70607224|ref|YP_256094.1| gi|449069738|ref|YP_007436819.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]