SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70607507|ref|YP_256377.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70607507|ref|YP_256377.1|
Domain Number 1 Region: 273-437
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 4.19e-41
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.0005
Further Details:      
 
Domain Number 2 Region: 79-285
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 1.7e-25
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|70607507|ref|YP_256377.1|
Sequence length 557
Comment acyl-CoA dehydrogenase [Sulfolobus acidocaldarius DSM 639]
Sequence
MSEDSWKNVYSYLSNSYGKNHFTIDKPFQQLLKYFRGAVPDLTPLGEFAGGELLEISDYI
DKGAHPKHIMWSIDGQRVDEVWISPMQRLVLERLLKEYHVNAYPYKGGDWFQHFASIYLI
SDPGIACILTVTNQTAYTLYKYGDAYQRTLVDGMIGENDKILFGATWFTEVQGGSDLGAN
LVEAYKDGNTWKLNGITKYFASDAGLAHYALVTARPKGAPSGAKGLGLFLAPKLDSSGRR
NFLIRRLKEKSATISVPTGEVEFHGSEAQPIGELNQGIYYTVETLTVSRIANAFGALGLA
RKAYLEAYYYAQKRKAFGKPLIEHPLVRRDLLDMEVYIEGTMALALKSVSEFQKSWMSTP
PYNENYNYARLLTHIAKNMTADMSAYVTKMAMELHGGIGFLREFPIERLHREALITPIWE
GPSNIQALDMLEALVKKKAHLTLIKDMENLVNQLKEDRDLGDLALRSINESLSGILGMQI
QDAQYYAKDLLNTLGNAVATVLLLHAGESLGSSRLRTVGKLYATRFLEGKVYPIEDLRGG
DVVFMIDEVELKAETNG
Download sequence
Identical sequences A0A0U2VYT7 M1IX41 M1J3E3 Q4J7Z7
gi|449067757|ref|YP_007434839.1| 330779.Saci_1778 gi|70607507|ref|YP_256377.1| gi|449070031|ref|YP_007437112.1| WP_011278586.1.100797 WP_011278586.1.13097 WP_011278586.1.15291 WP_011278586.1.18585 WP_011278586.1.18739 WP_011278586.1.19907 WP_011278586.1.20267 WP_011278586.1.24072 WP_011278586.1.28054 WP_011278586.1.30898 WP_011278586.1.31299 WP_011278586.1.33024 WP_011278586.1.33782 WP_011278586.1.34459 WP_011278586.1.34536 WP_011278586.1.35781 WP_011278586.1.35800 WP_011278586.1.36276 WP_011278586.1.37881 WP_011278586.1.38112 WP_011278586.1.38253 WP_011278586.1.39308 WP_011278586.1.39398 WP_011278586.1.43265 WP_011278586.1.4394 WP_011278586.1.45682 WP_011278586.1.48356 WP_011278586.1.49892 WP_011278586.1.50721 WP_011278586.1.51246 WP_011278586.1.5150 WP_011278586.1.53520 WP_011278586.1.55288 WP_011278586.1.55517 WP_011278586.1.56706 WP_011278586.1.57256 WP_011278586.1.64117 WP_011278586.1.64360 WP_011278586.1.67449 WP_011278586.1.68798 WP_011278586.1.7301 WP_011278586.1.74875 WP_011278586.1.78998 WP_011278586.1.8042 WP_011278586.1.83345 WP_011278586.1.87279 WP_011278586.1.90653 WP_011278586.1.90680 WP_011278586.1.95134 WP_011278586.1.96274 WP_011278586.1.97501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]