SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70607854|ref|YP_256724.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70607854|ref|YP_256724.1|
Domain Number 1 Region: 54-127
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000051
Family Multidrug resistance efflux transporter EmrE 0.031
Further Details:      
 
Domain Number 2 Region: 173-269
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000017
Family Multidrug resistance efflux transporter EmrE 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|70607854|ref|YP_256724.1|
Sequence length 275
Comment hypothetical protein Saci_2138 [Sulfolobus acidocaldarius DSM 639]
Sequence
MKILKYLIPYIIVGSLQYYFAKDAITYSSPVVFNLLRYIISSAIFLSIRRRIVFNRDVFL
LALYTTMSSLTWSLGLKYVSPSESAVLSYTMPLFSIPIAFLILSERPTVIETLGVGIGFL
GVTLYGLPLVHGFSLLGATLTIINAVFWALFSVYYRKLRNEDPIVVNASQFSIGSVILAL
LLPIDHDVTINDSFIEGTAYTATLGGALSFFLWNMMVKIERVPRVTIFSFSIPILTTIIQ
VVVFNTSVFLIQIAGIAIIFIGIILSRIRDFVKVK
Download sequence
Identical sequences A0A0U3H4V5 M1IG23 M1IYA2 Q4J714
GO.5168 gi|449068097|ref|YP_007435179.1| gi|70607854|ref|YP_256724.1| WP_011278933.1.100797 WP_011278933.1.13097 WP_011278933.1.15291 WP_011278933.1.18585 WP_011278933.1.18739 WP_011278933.1.19907 WP_011278933.1.20267 WP_011278933.1.24072 WP_011278933.1.28054 WP_011278933.1.29213 WP_011278933.1.30898 WP_011278933.1.31299 WP_011278933.1.3283 WP_011278933.1.33024 WP_011278933.1.33782 WP_011278933.1.34459 WP_011278933.1.34536 WP_011278933.1.35781 WP_011278933.1.35800 WP_011278933.1.36276 WP_011278933.1.37881 WP_011278933.1.38112 WP_011278933.1.38253 WP_011278933.1.39308 WP_011278933.1.39398 WP_011278933.1.43265 WP_011278933.1.4394 WP_011278933.1.45682 WP_011278933.1.48356 WP_011278933.1.49892 WP_011278933.1.50721 WP_011278933.1.51246 WP_011278933.1.5150 WP_011278933.1.53520 WP_011278933.1.55288 WP_011278933.1.55517 WP_011278933.1.56706 WP_011278933.1.57256 WP_011278933.1.64117 WP_011278933.1.64360 WP_011278933.1.67449 WP_011278933.1.68798 WP_011278933.1.7301 WP_011278933.1.74875 WP_011278933.1.78046 WP_011278933.1.78998 WP_011278933.1.8042 WP_011278933.1.83345 WP_011278933.1.87279 WP_011278933.1.90653 WP_011278933.1.90680 WP_011278933.1.95134 WP_011278933.1.96274 WP_011278933.1.97501 gi|449070415|ref|YP_007437496.1| 330779.Saci_2138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]