SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70607859|ref|YP_256729.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70607859|ref|YP_256729.1|
Domain Number 1 Region: 3-274
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 1.14e-75
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.00000084
Further Details:      
 
Domain Number 2 Region: 265-478
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 4.57e-65
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|70607859|ref|YP_256729.1|
Sequence length 505
Comment gamma-aminobutyrate metabolism dehydratase/isomerase [Sulfolobus acidocaldarius DSM 639]
Sequence
MVIRTGDQYVSSISKRSKVEIYVLGKEVKDVTKHPFLKPSVMSFKATFDAAWDEDTKELG
RAWSPYLEEEINRFNHIHRSPEDLAAKVKLLRKLSHKTGACFQRCVGWDSLNTLNIVTKI
MANKGRTEPRDRFVEYLKYVQKNDLALAGAMTDVKGIRTLKPSQQPNKNAYLRVTEVTKD
GIYVSGAKANITGVAATEEMVVLPTRAMGPEDKDYAVAFAIPTDTEGIKIVVGRQINDAR
RMEEGEIDGLPYFYNHEGLVIFDNVFVPMNRVFLAGEWEYTGTLVEIFAAYHRQGYGGCK
AGLGDVIIGASADLARQIGVEKAPHVQDKLTEMIFLTETMYSAGIAASLNAVKICDNCWW
VNPMHANVTKHLVARFPAQISQLAIDIAGGMVGTAPSEWDLKNPKLKEYIMRYLQGVEDF
TAEDRLRMVRLIENVSMGVAFQIESIHGAGSPAAQRIMFSRLYDLDLAREISKKLAGRKA
DLKMTTKPEPWRETQSEQEAKEHDK
Download sequence
Identical sequences A0A0U2YAB2 M1IG29 M1IYA9 Q4J6Z6
330779.Saci_2143 gi|449070420|ref|YP_007437501.1| gi|70607859|ref|YP_256729.1| WP_011278938.1.100797 WP_011278938.1.13097 WP_011278938.1.15291 WP_011278938.1.18585 WP_011278938.1.18739 WP_011278938.1.19907 WP_011278938.1.20267 WP_011278938.1.24072 WP_011278938.1.28054 WP_011278938.1.29213 WP_011278938.1.30898 WP_011278938.1.31299 WP_011278938.1.3283 WP_011278938.1.33024 WP_011278938.1.33782 WP_011278938.1.34459 WP_011278938.1.34536 WP_011278938.1.35781 WP_011278938.1.35800 WP_011278938.1.36276 WP_011278938.1.37881 WP_011278938.1.38112 WP_011278938.1.38253 WP_011278938.1.39308 WP_011278938.1.39398 WP_011278938.1.43265 WP_011278938.1.4394 WP_011278938.1.45682 WP_011278938.1.48356 WP_011278938.1.49892 WP_011278938.1.50721 WP_011278938.1.51246 WP_011278938.1.5150 WP_011278938.1.53520 WP_011278938.1.55288 WP_011278938.1.55517 WP_011278938.1.56706 WP_011278938.1.57256 WP_011278938.1.64117 WP_011278938.1.64360 WP_011278938.1.67449 WP_011278938.1.68798 WP_011278938.1.7301 WP_011278938.1.74875 WP_011278938.1.78046 WP_011278938.1.78998 WP_011278938.1.8042 WP_011278938.1.83345 WP_011278938.1.87279 WP_011278938.1.90653 WP_011278938.1.90680 WP_011278938.1.95134 WP_011278938.1.96274 WP_011278938.1.97501 gi|449068102|ref|YP_007435184.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]