SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70607955|ref|YP_256825.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70607955|ref|YP_256825.1|
Domain Number 1 Region: 1-170
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.76e-50
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0000315
Further Details:      
 
Domain Number 2 Region: 374-451
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 7.85e-23
Family CO dehydrogenase ISP C-domain like 0.00062
Further Details:      
 
Domain Number 3 Region: 304-379
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.98e-21
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.001
Further Details:      
 
Domain Number 4 Region: 179-283
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 0.0000000000122
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|70607955|ref|YP_256825.1|
Sequence length 459
Comment carbon monoxide dehydrogenase [Sulfolobus acidocaldarius DSM 639]
Sequence
MIPAQFKYYRPSNLQQALDLLKENEGARPLAGGQSLVPMMKLRIINVDTLVDLNDLDELK
YVKLEEDKLRIGSLLTHNEIATNHIIRQRYPSLAKASWVIADLQVRNKGTIGGSIAHADP
SGNYFPVLFTLEGKVILSSGRSINIEDFYLFPYTTALSHGEIIKEIEIPVKKNSEYWLNF
NVVKRGGASYPTCLVAVNLELSEDRVVVSSKIAIGGVFEKPVLIRDLFLGEKVDEIRRRA
DLDSIAEKIIAERDEKVINDIHASKSYRLKLTRNLLVKTLMGYSDIKLPSKEIVNTPNNH
SGSKYSLTVNGEEIPLNVEPRILLIDFLRQNGFTEVKRGCDEGKCGACTVLVDGKAIKSC
NAFAIQFSGKNIVTIKGLKTKQLVQDAFLRNYAMQCGYCTHGFMMTVYDYLTNVDPDADE
DLMKYAIKNICRCTGYVNIIRATKDLSRSLQNSSKLDKP
Download sequence
Identical sequences A0A0U3FH99 M1J1H4 M1J8L8 Q4J6P9
gi|449068201|ref|YP_007435283.1| gi|70607955|ref|YP_256825.1| WP_011279034.1.13097 WP_011279034.1.15291 WP_011279034.1.18585 WP_011279034.1.18739 WP_011279034.1.19907 WP_011279034.1.20267 WP_011279034.1.24072 WP_011279034.1.28054 WP_011279034.1.29213 WP_011279034.1.30898 WP_011279034.1.31299 WP_011279034.1.3283 WP_011279034.1.33024 WP_011279034.1.33782 WP_011279034.1.34459 WP_011279034.1.34536 WP_011279034.1.35781 WP_011279034.1.35800 WP_011279034.1.36276 WP_011279034.1.37881 WP_011279034.1.38112 WP_011279034.1.38253 WP_011279034.1.39308 WP_011279034.1.39398 WP_011279034.1.43265 WP_011279034.1.4394 WP_011279034.1.45682 WP_011279034.1.48356 WP_011279034.1.49892 WP_011279034.1.50721 WP_011279034.1.51246 WP_011279034.1.5150 WP_011279034.1.53520 WP_011279034.1.55288 WP_011279034.1.55517 WP_011279034.1.56706 WP_011279034.1.57256 WP_011279034.1.64117 WP_011279034.1.64360 WP_011279034.1.67449 WP_011279034.1.68798 WP_011279034.1.7301 WP_011279034.1.74875 WP_011279034.1.78046 WP_011279034.1.78998 WP_011279034.1.8042 WP_011279034.1.83345 WP_011279034.1.87279 WP_011279034.1.90653 WP_011279034.1.90680 WP_011279034.1.95134 WP_011279034.1.96274 WP_011279034.1.97501 330779.Saci_2246 gi|449070519|ref|YP_007437600.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]