SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70608039|ref|YP_256909.1| from Sulfolobus acidocaldarius DSM 639

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70608039|ref|YP_256909.1|
Domain Number 1 Region: 55-188
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 1.96e-42
Family Band 7/SPFH domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|70608039|ref|YP_256909.1|
Sequence length 258
Comment hypothetical protein Saci_2332 [Sulfolobus acidocaldarius DSM 639]
Sequence
MAISIGDIIGIVFLLIIIIILLSLSLRVIAEWQRAVILRLGRAIRVKGPGIITLIPFVDR
PIVVDLRIVTVDVPAQTTVTKDNVTVTIDAVLYYKVVDPMKTILSVANYNYAVLNLAQTS
LRDIIGQMELDEILVKREEINKRLQLILDEITEGWGIKVTQVTVRDIRLSQELLSAIAEQ
AKAERIRRAKVISSEGERQAASILADASQYYVSNPVALQIRFLEMLTDISQRGNMVIVVP
AGQEFYSTLSVLKSKPQS
Download sequence
Identical sequences A0A0U3FPP3 M1IYC1 M1J5J0 Q4J6G5
gi|449070603|ref|YP_007437684.1| gi|449068285|ref|YP_007435367.1| 330779.Saci_2332 gi|70608039|ref|YP_256909.1| WP_011279118.1.100797 WP_011279118.1.13097 WP_011279118.1.15291 WP_011279118.1.18585 WP_011279118.1.18739 WP_011279118.1.19907 WP_011279118.1.20267 WP_011279118.1.24072 WP_011279118.1.28054 WP_011279118.1.29213 WP_011279118.1.30898 WP_011279118.1.31299 WP_011279118.1.3283 WP_011279118.1.33024 WP_011279118.1.33782 WP_011279118.1.34459 WP_011279118.1.34536 WP_011279118.1.35781 WP_011279118.1.35800 WP_011279118.1.36276 WP_011279118.1.37881 WP_011279118.1.38112 WP_011279118.1.38253 WP_011279118.1.39308 WP_011279118.1.39398 WP_011279118.1.43265 WP_011279118.1.4394 WP_011279118.1.45682 WP_011279118.1.48356 WP_011279118.1.49892 WP_011279118.1.50721 WP_011279118.1.51246 WP_011279118.1.5150 WP_011279118.1.53520 WP_011279118.1.55288 WP_011279118.1.55517 WP_011279118.1.56706 WP_011279118.1.57256 WP_011279118.1.64117 WP_011279118.1.64360 WP_011279118.1.67449 WP_011279118.1.68798 WP_011279118.1.7301 WP_011279118.1.74875 WP_011279118.1.78046 WP_011279118.1.78998 WP_011279118.1.8042 WP_011279118.1.83345 WP_011279118.1.87279 WP_011279118.1.90653 WP_011279118.1.90680 WP_011279118.1.95134 WP_011279118.1.96274 WP_011279118.1.97501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]