SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AC00692-PA from Atta cephalotes v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC00692-PA
Domain Number 1 Region: 1-235
Classification Level Classification E-value
Superfamily CutC-like 4.84e-66
Family CutC-like 0.00000642
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AC00692-PA
Sequence length 241
Comment ACEP_00000692-RA protein AED:0.00619834710743805 QI:0|-1|0|1|-1|1|1|0|241
Sequence
MEICIDSLESARNAIEGGASRLEVCSALSEGGLTPSLGLVQQIKSFTTIPLYVMIRIRCG
NFIYSSEETDAMLYDLKILKDHHVNGFVFGALTSDCDIDIVACKKIISAACPLPVTFSRA
FDLTNDPIKSMELLADLGFERILTSGQKNTALEGLELIKMLVQKAQKLVIMPGAGITKDN
IRKIMESGAKEFHASAKKRKMVIYGANKVKMGINNDDFVNVTDKELVKQLVEIIKNEKYT
T
Download sequence
Identical sequences A0A158N9Q7
AC00692-PA XP_012054265.1.45171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]