SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AC06056-PA from Atta cephalotes v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC06056-PA
Domain Number 1 Region: 144-269
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 2.15e-28
Family Insect phospholipase A2 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AC06056-PA
Sequence length 272
Comment ACEP_00006056-RA protein AED:0.129913361492309 QI:0|0.66|0.5|0.75|0.33|0.75|4|0|272
Sequence
MLIIYRNTNVTLRQVWLRKSNRKLQLIYAGETLTDCIDEKLAWWDDSECLPSSRGVYRYH
DDGDEVSIEVFQLDGKDISRIPRDLSWLLSTSELRHRCDRMRMRIRSQAMAQYRHRKYAK
STNATANNGKQNRSRNRIRRELFMIPGTQWCGRGDRATKYTNLGGFGMADACCRKHDTSC
PFHIPAFETRYGVFNWRISSMMHCACDERFRTCLKMAGTASADFIGKIFFDVLQSKCFIL
KSQKVCVKRSWWGKCQHHEYRKQAYVRDNVPY
Download sequence
Identical sequences AC06056-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]