SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AC06760-PA from Atta cephalotes v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC06760-PA
Domain Number 1 Region: 136-191
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 1.74e-17
Family Insect phospholipase A2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AC06760-PA
Sequence length 192
Comment ACEP_00006760-RA protein AED:0.343443433013485 QI:0|1|0.5|1|1|1|4|0|192
Sequence
MSICSLTAQQPTFFFRNTFKGLSGLTPSAVALMKDEMRVVYYHEQTVAVVDLGPRNELHD
CNIIEVYEPFEATEVLRNLSMTLHPQVVSFQEITRLMQQCELLDKLQVEVTSTLPTNALS
RGTRIAASSITLFSGILPGTKWCGTGDIAENYHDLGDLPHIDRCCRNHDLCPIKVRAQQT
RYNLTNYSIFTK
Download sequence
Identical sequences AC06760-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]