SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AC09543-PA from Atta cephalotes v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC09543-PA
Domain Number 1 Region: 77-127
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 8.37e-18
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00023
Further Details:      
 
Domain Number 2 Region: 30-78
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000000000392
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AC09543-PA
Sequence length 137
Comment ACEP_00009543-RA protein AED:0.292828878692982 QI:0|0.25|0.2|0.4|1|1|5|0|137
Sequence
MRSFLRVKVRACRARTRHDSIASNVVGRDVLRNTTLGNTLQESLDELIQYGQITPQLAIK
VLLQFDKAINQALATRVKSRLTFKAGKLNTYRFCDNVWTFMLNDVEFREVQEVAIVDKVK
IVACDGKTLDADGAAKR
Download sequence
Identical sequences AC09543-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]