SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AC15534-PA from Atta cephalotes v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC15534-PA
Domain Number 1 Region: 314-371
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 9.68e-23
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00012
Further Details:      
 
Domain Number 2 Region: 5-49
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000392
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00051
Further Details:      
 
Weak hits

Sequence:  AC15534-PA
Domain Number - Region: 271-304
Classification Level Classification E-value
Superfamily ARM repeat 0.00403
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AC15534-PA
Sequence length 371
Comment ACEP_00015534-RA protein AED:0.044861909921925 QI:0|0.5|0.28|0.85|1|1|7|0|371
Sequence
MALSQTSVLKLYNTVIEDVISGVRESFIDEGVDEQVLLELKQIWEGKLMASKAVELNPDP
PEPQVPQINTHKAVSVNKANVGNHFVQPSAGNTVPQTQPQQQSQQQQQQQAQSQQSSQSQ
QHTHPSTGTTLQQQQQHSTTPVQQVVTASTVLERQVPIQITLPPQAGVPDGPQRILSIQV
PASALQANQLHTILTGPVISAAMGLPANLASTLLQQHVNSTLQGQAALTPLQVNQPLQVV
TQSTNSVVTQRPPQNQQQNNINQLDGGVGDSTDDDDEEEEEDNDDDDEDIDEKEEEENDE
AAAREEEPLNSEDDVTDDDPADLFDTDNVVVCQYDKITRSRNKWKFYLKDGIMNLSGKDY
VFQKANGDAEW
Download sequence
Identical sequences A0A158NUK7 A0A195BFB8
AC15534-PA XP_012061215.1.45171 XP_018048229.1.4000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]