SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AC05049-PA from Atta cephalotes v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC05049-PA
Domain Number 1 Region: 15-177
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000231
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AC05049-PA
Sequence length 273
Comment ACEP_00005049-RA protein AED:0.333684210526316 QI:63|1|0.5|1|1|0.5|2|65|273
Sequence
MNVTGIPQCSRPTCSNPSGYRITSRFHCIPRRNNTLSCSLRYVDGFDFGMIGEEDVVSRR
KNITEAPIELFFDEKGIENIITSQLTRFYDLNILKMVAEQLHPGDNFNNIGDGTFEGETA
STIGRCNATFDVYHHSGDGNPNETRFRLKLLSPRLHMTSTETLIINKQTNLNHCSCYADS
YFRKYGDTIVYQRLQADLDIMISHMEISETSFSSSTTRKGTSVSNHKTYNIIEITKIILE
DIQPATKDPPAIVKPGETKILANYDIKSISTSY
Download sequence
Identical sequences AC05049-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]