SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AC05513-PA from Atta cephalotes v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC05513-PA
Domain Number 1 Region: 36-269
Classification Level Classification E-value
Superfamily L domain-like 8.42e-44
Family Ngr ectodomain-like 0.0034
Further Details:      
 
Domain Number 2 Region: 266-363
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000131
Family I set domains 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AC05513-PA
Sequence length 782
Comment ACEP_00005513-RA protein AED:0.0142124991415644 QI:0|1|0|1|1|1|3|0|782
Sequence
MIPRTASRWLLCVALTVALCQGQEDWMQCSSTCKCKWVSGKKTAECIKQNLTQVPGDLSP
EIQSLDLTGNRITHLIRDAFSRVNLVNLHKLSLRDCGIEAINRDAFSDLKIIIEIDLSGN
NIRNLHPSVFYETQKLRVLLLDQNKLRMLDNGLFFNLTFLQKVTLSDNRLERIEEQAFRN
LPNLHSLALDGNNFSTLQLQSFESLPKLGSLELQNNPWNCNCHLKKFRDWAIQRKLYTQP
TTCQQPPHMIGKMWDEVSSDDFACRPKITNIEPSNKIETAKGDVTISCKATGIPHPELSW
TYRNRLITNSTKHANDKNYILLANHDWLNLTIIDALPADKGDYVCHAKSPGGEAEKNVTL
SIIGDALGGRENFISLPLAIGLGVTALCLLIVTVVLCVCYCRRRHTRHDEKGLEAASLEH
HGLGEQEKSLITTINPVVKPPRRYEAPSVTSHSTEMTELNRTLLDNDSVFADGVGSGVVG
GVGGGVGDDEKEHERATPELDGGGNGGGVGGGSGTLPRGGAGYHHRQYPPDLLAFSGGRG
ASPTSQASTAPDSTRLPSQQMITPAAAATTAATASSYGSPPSGQYHPAAFKTLPHSRSAT
PYSLGPSSSSSPLAPVLPRHGYVTIPRRPRAPSWSSAPPTSPTDALEPVYDNLGLRTTAD
GSSMLSLNKSPEPASSMRGRPLPGTPGGSHYGSIQRSTPNILTSNPLDRVAPEGAAEWPL
KLTDESMDGGHLLLTQQQQQQQAAASNTLGRKVPPRPPPKPKKKSANGPTLYEDEGEDGT
EV
Download sequence
Identical sequences AC05513-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]