SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AC09953-PA from Atta cephalotes v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC09953-PA
Domain Number 1 Region: 1027-1322
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.88e-85
Family Complement components 0.0000156
Further Details:      
 
Domain Number 2 Region: 1392-1523
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 7.72e-33
Family Alpha-macroglobulin receptor domain 0.00037
Further Details:      
 
Domain Number 3 Region: 859-973
Classification Level Classification E-value
Superfamily E set domains 0.00000000098
Family SVA-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AC09953-PA
Sequence length 1897
Comment ACEP_00009953-RA protein AED:0.178498604070841 QI:0|0.52|0.61|0.76|1|1|26|0|1897
Sequence
MGNPSALLFTGCTTSTGLDQGPRIETCLELAVPFTKYFNGRLRLKIKFDKYPDYVVETEK
EVYIEHDSLITFVETDKPVYKPGQDVNIRILMLKHDLKPWKKTNEKSVYKKVGIMKKNKQ
KIPKVWIENPSEVRVAQWANVSTENGMAQLKFSLSPEPSPGTWKIKVEKRRSQPQLIHTT
VFEVKKYVLPRFQVTITSPGYILADAENVTWNICAKYSYGKPVKGKLLLKSTPQIPTWRR
KPNLPEIHYETELDSPDGCTEFVLSGAVLGLAQWKVAPNNIVLIANFTETGTGIVETSIS
RTVVVHQALKLEFLPYTPKYFKLGLPYHGKLRVSRHDNTPAPHEKIQLCVRVRGKDEWLR
VVVECRNFTSSSDGFVDFVVPPPHRNIVLLSFVATGIDYPTKYYSPDTRWRSEETTKKKV
FMDQPSAHIEVNPWYSPSDSYLAVARGYQPIVCGEKYSFNVMYTVPAKSKTNESISFHYS
INSKGDLLIYGHVKHRPTRDTILNYSEFRNLLGAVESPGNKTDQGTIAHRFPLSVKITPS
MAPVSELLLYYVRSDGEIVATTYSIKVGHCFENKVKTAWHTDAQTPGTATQYHVEAAPWS
LCGISAVDKSTRFLAGAKANLIDADQTFAQMKRFHIEPEPRPIWTWTHCKTATHEETINT
EFDHLPMPAFEESPSPPWELKRRRRTVYNGGLVNYVDAIQAFDKGNYMSIGSCSVFQDFG
AVVMSDLILETRPCLQLRRGRGRSMNVKASMIATPAIPFFSASADMETDAGMFKAKTLPM
AYPLLNVGPEQGYVDQASDQPPLRSYFPETWLWELVPTGKEGKVTVERTLPHTITDWIGY
TACVSPTHGLGIAPPTTITGFQPFFLDYSLPYSVKRGEMLRMKVSLFNYMQHSLPVKIKL
EDATGLDLHLSHAVASFCVKPRDSVVHEYILRPRVLGDVNITVSASIDSDYAEPCGPEVL
VYTRDVIVKPILVLPEGFPVEMTKSAFICPKDFSDDSTITWNLDLPNDLVPESARAYVSL
IGDILGPALENLDKLVRLPMGCGEQNMILFVPNIHVIGYLDASGIDNPELRAKAIKNMEK
GYQRELIYRHPDGSYSAFGPESSEDGSSIWLTAFVIKSFAQAKNIIHIDERDLKISVKWM
VKKQLENGCFPVIGRVFHKDMKGGLQDDDTSSSALTAYILISLLESGVPLTASLINNALH
CLEKGMENDSGTTYTAALSTYALTLLEHPKANNSMKLLMKRATRNNDLLWWEDKHKPSLG
LSIEMTAYAVLSLVKLGGETNMVEALKAVRWMSKQRNAEGGFTSTQDTVLGLEALTKYAA
AMSSNTTDLSVLVTAGEVDQVYRMYNDNRMVLTQIRLPVIPTIVEIFAEGEGCVLVQSNI
KYNVAHATGSEAFDLSVNAAPATWLDECSRQKITICTRYKMADGESNMALLEINMVSGYI
PDRTSLHSLLEDPATKVKRFEDDRGIVTIYFDKLINQKTCISFTVTRENIVDRLEPANVK
LYDYYQQELTISSSYSFAATCSSATPSEEVEVPNPVPIEVQEMGKDTAKKDTVEKEEDVI
EKTAEIPNDRNGTVEQIGNTTQNSDLVKQLRDKITNEKSVTGIQSRSEDISPVDNSNPKV
NNDDINTVMNVSAANNNSVESVPQREAGSGQTPDEPDINLNPVFDRLGPPSIDLEDMEAP
FLTFNRQGQDPFATDFDRNPLFVVVDHELATPEGIEGPVPVSVKPGIIYFDDNPLSNMTN
ETDQKIEMDLNNNETLPPLGLNDSCPICADELPSNINDLYCSASSVVKAAIRRLRKARLL
LDMQSSHEVTRLHSMIAFVLRPNCSCPPLDNPGSLALLMHFEDGEFAKRSHNRYVLDEQI
SIYGLPPIGGVPREITDARAMCANQDNSAFLNLPTAD
Download sequence
Identical sequences AC09953-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]