SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AC14734-PA from Atta cephalotes v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC14734-PA
Domain Number 1 Region: 38-273
Classification Level Classification E-value
Superfamily L domain-like 8.5e-46
Family Ngr ectodomain-like 0.0026
Further Details:      
 
Domain Number 2 Region: 271-378
Classification Level Classification E-value
Superfamily Immunoglobulin 2.26e-17
Family I set domains 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AC14734-PA
Sequence length 759
Comment ACEP_00014734-RA protein AED:0.0310444729648895 QI:0|1|0.5|1|1|1|2|0|759
Sequence
MCSIVLVWRWRVALFSTMLLLLSWGTNAAEDCPSMCACKWKGGKEWVECANRDLKGLPQG
AREETQVLDLSGNHLVNLPAECFRALGLINLQRLYLGKSRINQIASEAFVGLVGLVELDL
SENQIEQVPTDTFASYPSLMRLILNGNPIREIRQNAFLRLVHLTNLEISKCVIEIIEQNA
FEGLQSLEWLRLDGNRLTYVPDHTLPLGGNLRGLTLHNNPWQCDCRLRIMQTWLKESAPA
APQESEPICDSPARLHDKQIKSLKINELACLPRIDLQDHLDIYEGGNITLRCDVHAVPTA
KVTWWFNGEPCELQHENNSMASSISIFPRYIYRQRGGTNMSSTLFLYSVESLDEGTYSCI
AENSAGSAVANLSLRVFFREKPTVEPPFDNPGSGYVAAIVAGALVGTLLALSCLVGSVIY
CAKKRRRDRKRNSKALVTQSKSVLPITKDTTSSSYRKGNGSLIGGLEHQQMVSYTEREIN
RAATLERREHTRNNHLDRDAYSVASPVAKYLTEPDLINEVPENSEVGYGQLYGRHHQRAG
VDRQVLEYDSGYPLQPDLRPPPVLSQMNYLDQDGYPLNFGLPKITFSTASTLPRLRQRMT
EPGSAAAPAARYSREAEFLARSPGYDPILPRTDARYTAEGYPYPVHQHQHQHQHQQQQQQ
QQSQTIQPPLSIQPVEQPIQQQLPIQSPVSPVAVFPEVPFIPSPPAAYRGETTPLSPRSL
LSKTAREAAAAAAARAEELQPPNHPESPDEGYVGDAMDV
Download sequence
Identical sequences A0A158NSY5
XP_012060643.1.45171 AC14734-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]