SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AC16903-PA from Atta cephalotes v1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC16903-PA
Domain Number 1 Region: 109-496
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.45e-23
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.03
Further Details:      
 
Domain Number 2 Region: 2-104
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 1.96e-21
Family Lipovitellin-phosvitin complex, superhelical domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AC16903-PA
Sequence length 670
Comment ACEP_00016903-RA protein AED:0.0222849037022784 QI:61|0|0|1|1|1|2|2|670
Sequence
MMVISLSKLTESYPRVVRSVALRIYLNLKEVYELRCVAVHIIMNTNPSLLILQRLAEFTN
QDQDRHVNSVVKTSIESLINLEQTEWNDLAEKARIASKLLNPNISEDNYSKSIFMQTIIA
SLNVAQTNIFQIIGSDDTNTPKNAYIDILQSYGGLTLPLTKMAYAVSSIEELKQQWLDIL
LGKRPWMPQNQTRKEWMIETIVEKLGIEPENAEQLEGNFFLDSAFSLGFYPFDNYTLEEF
TNILKMYYKSISQIGSYVFEYKNINDLNHYDITLGFPTETGLPFIYTLAVPKITSINKGG
SVKVTHLQNDSFVELAVTGYIVSSEKIQSRIGFVTPFEHRYYIAGVDINTHIAIPAGLNV
KTKGNGTYELKIHPHYNPHVGRVSIRQLAIHHSVVPYTSRQDILQLLEFSNDTRLVHTKE
PNQVQFSLGNLTLSARSDVIDNDMSQKKGLEGLIKLSTIFYLNLGAHYRRFDVILYPIDA
QINLTYYVERTNRSSEATIPTIIDKRPNSREREAQFVDELTITKDNRSDNYVYSVTTSTM
YDISVLIDNNYYVFTFVLGDTRDKLQTLFYGNIQSLDGEVSWEFCNVNSIVGLSQYNHLN
VEKAIKKIPNYEFNSEMRYGSCASGETIKLKGNLSRTDEVIKKAMKSEIVEECRQQMKQG
NIWLPTCQKA
Download sequence
Identical sequences AC16903-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]