SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|83727|estExt_fgenesh1_kg.C_10018 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|83727|estExt_fgenesh1_kg.C_10018
Domain Number 1 Region: 2-186
Classification Level Classification E-value
Superfamily ITPase-like 1.94e-60
Family ITPase (Ham1) 0.00000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|83727|estExt_fgenesh1_kg.C_10018
Sequence length 188
Sequence
MLKPLTFVTGNANKLKEVQAILSAGPHPVEITSQSVDIPELQGTTQEVAIDKCKRAAEAL
QGPCITEDTALCFEAMNGLPGPYIKHFLAALGPAGLNTMLEGFPTKAAWALCTFAYSAGP
GSEPILFEGRTDGKVVQARGPQNFGWDCCFEPDGYDMTYAEMPKDEKNKISHRYRALEKL
RAYLQSQA
Download sequence
Identical sequences D8PNF4
XP_003036422.1.72525 jgi|Schco1|83727|estExt_fgenesh1_kg.C_10018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]