SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|105805|augustus-scaffold_2.g1038 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|105805|augustus-scaffold_2.g1038
Domain Number 1 Region: 34-78,111-544
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.2e-71
Family AAT-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|105805|augustus-scaffold_2.g1038
Sequence length 548
Sequence
MQGNLDVTAASVEPLASTQSSEARQVPRVDFQHLRHHLNKLSRSRAPSPLKDIFRYMGLD
GMLSLAGGLPHPEMFPFLSMNVSAYDSDTRLATTSDIASIRTTDVTVPKNADGLHSTNLA
TTLQYGDARGLAALTSTIKRFVERLYKPAYSNYEIVLSHGSTDAWNKVVSLFVEFGDTIL
VEGQTYPSSQTVWIPMGCVSAPVTLDKDGIVPDALDELLVNWERTHPEQKKPRLLYCIPA
GQNPTGSTLTAERKAKIYEICVRHDIIICEDDPYYFLQFPTYDPQARSGPPADADAPVNI
PAFLESLEPSFLKYDYDGRVVRLDTFSKTLAPGFRVGWVVANSLFSERLIRANEALTQTP
SGWSQAIVTELLATWGDDGYLTWVKHLRDTYTARRNWMCGFLDRYFDVDWNSMSADGVPV
YLKQTTGRCQGPVIFKFVPPRAGMFVWLTIPLDGNAHFQRILASSDGGSDAQSPEAKWTT
EVWEKLAEARVLLTPGTYYTPWQGHEKAGQSDTPGVAFFRMSFSLMTRDNMDEAIQRVER
VFREEWTT
Download sequence
Identical sequences D8PSM8
jgi|Schco1|105805|augustus-scaffold_2.g1038 XP_003035265.1.72525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]