SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|114118|augustus-scaffold_14.g52 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|114118|augustus-scaffold_14.g52
Domain Number 1 Region: 1064-1262
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000915
Family Tropomyosin 0.0024
Further Details:      
 
Domain Number 2 Region: 902-1136
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000327
Family Tropomyosin 0.0017
Further Details:      
 
Weak hits

Sequence:  jgi|Schco1|114118|augustus-scaffold_14.g52
Domain Number - Region: 39-81
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0595
Family Chromo domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|114118|augustus-scaffold_14.g52
Sequence length 1551
Sequence
MAGKRKHVEDDTSPRDDVHEFSPPLEGEQMWTGSIVGEREDAYKIKWDPDRRTGKKYRPT
WEPKKNCNEHMVKDWRRRVKQEKNVSSRTTSTSSARDRSPSPARPAKKRKVGAETNAPMR
GKESASQAVTRVGPPKGKRKATQDASQKSTQSYGVARRATEPDASRQERESTAARRHSES
AAAARQTRTVNAPAASTSRASTAAKARRTDDTESTRSKTSSSAVSRIPTSIEPHIKARLK
IYDTKRRQLADPSLPPPPFKARQPATTVDDFPSASRPSSPQPPSQRRQRPQSPTHHAPRP
PSPFATSPDKPPSPVPSRSRSKNAAESPSRSPSVEVGRKRKKRPAATSKPLKPIPRVSPS
VFNDLAGPSSSLNGPPPSGSHIESAGGPTQTETISEFSPEKRRSGIHDSREEDDTIEGSS
SQPSLNRRVLDGARALAERIGNGGTAAQNRLRRPLGDILGSKAQRQRVFSGSIPQRQADD
VPEEEISGTGGTQGLSQDAGMEDDGGTQDISSTQDISMSIGVNGDEEMDDATREMESYVD
FEGGAEAEAPKDPIALREEMEESTQDLRDEQQARLQDASKAAEVDMTKASTKVHPPTQQN
KLAPASPLPAAPSRKPGEDTSASFVPPTPDESQRTTNTQSSQDQRILELERDLTSSQAEK
GSYEARSQELEAEKEILARDLASSQAESQSLSAKVADLGGLLERAQLELGAIQRRHEAEA
KKKEAAWKKDQADWKKERKEWEKERSAWKEKELEWEAKGAHWSEEKMALEQRCRELEEQA
KARDRVWEAKERAWSDKEHVQAEKENRWSQKEADWAQKEQKLQDTLREHEVQHGQTVRDL
EEKLRKVQEEMVEKVRRVQEEVGEQSMAEWAQERGNLERRNTELTAANAEVTTANAGLQG
KIASLELANTDLQRKNGDLERHISALEDMIADLQEENATLEDKNAELQTTIADLNVRLAS
VESSLAGKAREVEQAKLDLAEVKKEHEQVIPFLAERDQALATLKDRHAQTEQTLALKSEE
LSKHQQELADFYMQRADASKELTDVTKQLEDTVKKLEDTTSTLETLRKHKELDEREWADQ
RAALEKNVEVLIQQTAAEWQGRVAEVEEKLKIAEERVKDAESRVAEARKEADALKEARGS
SANASVMAKLAEGRAMMAEDATKQAEERASKLEARAIAAETRLADADTRAAAAESQLQLA
QKQLVLAQAELKQVKASLRSAEDAHSSSQTKVEAIESQLAALETSAVNQTLAHTSTEEDL
KSQLAARDARESDLRSEIASLHAQLAASVSTSGDTAAPASDEQLVGFEARLAELEARLAS
ETRARKAAEDDAEFVREQYRVASAHVGDMRKEIVALTNRTNIAEDQVARGLATVRETLLG
RTRTLEAERDRWRKQAEWVRELDARTNGDIRRKAAERDDLAERVEALAMERRKLAVQRDK
LEEERDDAVEARDQALVKRDKLVAERDGLNARLATLEATQAQSAQQIEEQTAEIATLKKS
LQTVRAQLEQTQHDTQPVYRCQWHHGGASCEALFASIEDLESHVRQSHVNE
Download sequence
Identical sequences D8QJU5
jgi|Schco1|114118|augustus-scaffold_14.g52 XP_003026679.1.72525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]