SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|15883|fgenesh1_pm.C_scaffold_5000279 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|15883|fgenesh1_pm.C_scaffold_5000279
Domain Number 1 Region: 59-171,262-374,402-494
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.59e-54
Family Pyridoxal-dependent decarboxylase 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|15883|fgenesh1_pm.C_scaffold_5000279
Sequence length 1020
Sequence
MHESISAWFLGPRAENYDLLKQLFAGAVDSHARVRENYYAEDGVFITDSIKESKTYQANV
TQLREQTCQIVDLLNKYSVPFFSPRYAGHMSFETSLPGIVGWVATILNNPNNVAFEASPF
TTLVELEVGSELCSMLGYPMDTESTIQPWGHIACDGTIANMESMWVARNLKFYPLSVHAA
MTDPEGPLRFVADSFKVPTADSPHEPQLFKDLDSWQLLNLPISVTLGIGEELLLQYGITN
DFLTSALSPYLVQSTGMEELIRKYNITAPPQYLISNTKHYSWPKSAALVGIGSSNTIPIP
VDSDARINFEKLDALLQERLDNKQAVYGVVAVIGSTEEGAVDPLDKVIELRNKYAELGMT
FVVHADAAWGGYFASMIRDPPSGGISRDDDEEDEDGSRDFVPSITMREYSVRQFDALKDA
DSITIDPHKAGYVPYPAGGLCYKDGRMRYLVTWTAPYLHDSNTGESIGVYGIEGSKPGAA
AVATFMHNNIVGLHKHGQGALLGEVAFTCRRFSAHWAAMSDDKTDFIVVPFNKFVHEADG
DAAILEEKAFIRENILGQSNQAIVQNKDALDEICGLGSDLNINAFACNFRINGEVNTDVA
EANYLNSRIFDILSLTGVGELPETIPMFLSATTFAHADYGECADAYKRRLGLETDSEQDL
FVLRNVCMSPFQAAGDFVQELAKIFQETLENEVQVVVKRNTVSPQIHEFTMQGNEQLYLT
YRPLFNHANGRQQVILRVGEMPADAWEKYKAAVAKFPGSTYTLRTSELDLQAVDLSKVEI
VKQRALNSAYYDKAYPKTTTPFYVYGSPTEVHADHMLLRAPNAQISSAHVKLGLESVLSA
EQLARGVIAHVEVPEQALQPLAEQHPFSPGAKFRVTITEDAFDATAHGPNLAEGGAQLAT
GTLTLGRALNTQDFEVDKRAADYTSTGASGETKAEWARVISEELGLKPAGGKVVQPPKGS
NVGSGSGLGLGARVFQAGGEVAGGAVNAGGSVAGGAVKGGLEVTEGMRKAGQTLFSGFRL
Download sequence
Identical sequences D8Q5H7
XP_003032313.1.72525 jgi|Schco1|15883|fgenesh1_pm.C_scaffold_5000279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]