SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|63342|estExt_Genewise1Plus.C_10886 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|63342|estExt_Genewise1Plus.C_10886
Domain Number 1 Region: 93-419,462-517
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.77e-70
Family GABA-aminotransferase-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|63342|estExt_Genewise1Plus.C_10886
Sequence length 530
Sequence
MTVEAAFYKLPGSAIVERYVRSSHQNDPGRTLLEIILFIFAIRTVFQRRTRSSSEKHFIE
FSEKEIDELVDEWTPEPLGQPLSEREQNELAAVPVIAGPNGPKPKLASTGKTAINLCSYN
FTGLAGNEHIKERAIETLRKYGLGSCGPAGFYGTLDVHVDLENNIAEFLGTEAAILYSQG
FSTIPSVIASFCKRGDIIIADRGVNFAIQKGIQISRSTVRWFDHNDLQSLNDVCEAVDRE
QRKKRAPLTRRFIITEGIFEKDGQMVDLPKLIELKYKHKYRLILDESYSFGTVGRTGRGL
TELYNVPASKVDMIVGSVAIGLCSSGGFCAGSKIAIDHQRNNGASFVFSATSPALLAVSA
SEGIELLKNSPSTLEALRENVRVARSVLERVDGISIPSHPASPMIHIFLKSANDIQREKA
SATLHPATATKPKHSDPRSVLPRDANTWDWDIEDEERALQEVVEDALVQGVMISKAKRLR
GQEIVEPRPSIRLVLTAALSKKDTEKAVGIVKASLQKVIAKRRHTGHLLN
Download sequence
Identical sequences D8PR11
XP_003038014.1.72525 jgi|Schco1|63342|estExt_Genewise1Plus.C_10886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]