SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|69476|estExt_Genewise1Plus.C_80352 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|69476|estExt_Genewise1Plus.C_80352
Domain Number 1 Region: 91-505
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.06e-100
Family Pyridoxal-dependent decarboxylase 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|69476|estExt_Genewise1Plus.C_80352
Sequence length 547
Sequence
MPSEIAWKQYFDVLKNVVCVYIVARQLLKLKRHVLARGLTGSVYEVYAAMQQRAFQLALR
LPSMQKKVRTEMDKAKLDIENKLVPKGPDVTRHLTLPPSGLSAEDIFAEMDKLDKEGLSH
TDWSKGKISGAVYHGGEELSKLIAAAYTRYLVSNPLHPDAFPAVRKMEAEIVSMVLRMYN
NPTGAGTMTSGGTESIVMAVKTYRDWARATKGITEPEMVIPSSAHAAFDKGAAYMGIKVH
TIPVDPVTRRVNIKRVRRAINSNTILLVGSTINFPDGNQDDIVALGQLAKKYGTGLHVDC
CLGSFIVPFIEPAGLADDEHFKLLPFDFRVEGVTSISCDTHKYGFAPKGTSVIMYKDASL
RRFQYYVTTTWSGGVYASPSLSGSRPGALIAGTWAAMQHIGYEGYLKSCREIVSCARYIA
RRIEDEIPELHIMGAPPASVVAFAANDDKKLEIFEVGDAMSRRGWHLNAINDGAPGGKGV
HLAVTRLTVPNQDVFIEDLKDSVREAGVSPSGKGTMVALYGLGSSSAIGPSLVGELAEAF
IDATLKA
Download sequence
Identical sequences D8QBQ8
jgi|Schco1|69476|estExt_Genewise1Plus.C_80352 XP_003029702.1.72525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]