SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|78406|estExt_Genewise1.C_80986 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|78406|estExt_Genewise1.C_80986
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.96e-31
Family Ribosomal L11/L12e N-terminal domain 0.000016
Further Details:      
 
Domain Number 2 Region: 75-148
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 9.81e-19
Family Ribosomal protein L11, C-terminal domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|78406|estExt_Genewise1.C_80986
Sequence length 165
Sequence
MAPKFDPNEIKIIYLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKATSQWKGLRVTV
QLTIQNRQAAVSVVPSASSLVIKALKEPPRDRKKEKNIKHTGNITLDEVFDIARTMKSKS
LAKELSGTVKEILGTAQSVGCTVDGQPPHDIIEGIDSGDVEVPEE
Download sequence
Identical sequences D8QCY7
XP_003029916.1.72525 jgi|Schco1|78406|estExt_Genewise1.C_80986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]