SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|80399|estExt_fgenesh1_pm.C_10380 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|80399|estExt_fgenesh1_pm.C_10380
Domain Number 1 Region: 11-59,106-400,435-531
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.51e-65
Family AAT-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|80399|estExt_fgenesh1_pm.C_10380
Sequence length 535
Sequence
MFSEKPLPDAIDLSHHLSKVAVARQVSPLKGLQKYMDKPGLISLAGGMPNPSYFPFHSLG
AEVLVEDQFPLNPSQSSSGLSWFWKLFGSKQVERTTAVSIPKFANKPGEIDLATALQYSM
AKGLKPLQDFINDFVGNVYQPGYANYTTIVHAGNTDGVNKSIMTLCNPGEGVLVSEWTYP
STMATMKPLGVSPVPVGMDGQGMSAVALDKLLSEWDVEARGGMPRPHVLYTVPIGQNPTG
ATMGAQRKKEIYAIAVKYDIIIIEDDPYYFLQQGEYVPKGERKEEEVKTHKDEAKHFIAS
LAPSFLKFDYQGRVVRLETFSKTVAPGSRLGFFTCNAVFAERFERQGETSTQAPCGFGQS
MVASLLLQWQYSGYIRWLRALRLQYKQRRDFFIDCFDDEFNMRRSIAVSGAHQGAVVYEG
SLKPLRGEKFAASGKTLFSFVPPTSGMFVWIKLHFDEHPEVSTHGMKELEMKLWTALAEE
GLLFGPGNMFSSANLTDDYEGPGHFRISFSNADFDELKRAVELFQHVTRKFFKDL
Download sequence
Identical sequences D8PRN7
jgi|Schco1|80399|estExt_fgenesh1_pm.C_10380 XP_003038081.1.72525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]