SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|82237|estExt_fgenesh1_pm.C_50136 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|82237|estExt_fgenesh1_pm.C_50136
Domain Number 1 Region: 198-473,521-647
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.02e-86
Family GABA-aminotransferase-like 0.0000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|82237|estExt_fgenesh1_pm.C_50136
Sequence length 679
Sequence
MPSGSPLPSPMAFVRSSTSSKSLFRKKSAQSLPSSAASLLSAVSQADAQARAAGRPASTT
STVPALTMSSGASFSSAGTAMDVDDNEDGLAYPIRSPPTSEQVFTTAHTEFGHCANEEYR
SASAHDESVHGVPEMDPPYFILMTTYISYLLLIVLGHVRDFFGKRFYPKSYEHLVPVNGY
APLTSDFDSFYTRRLKTRLLECFTQPVTGVAGRTIKFIDRYSTDWNETMIHPGTTTRTLN
ISSYNYLGFAQSLGGCADAVEESLRRYGIASCGTRMEGGSSELHNQAEALVARFVGMEDS
VLSSMGFATNSGLIPALVGKGCLVISDELNHASIRFGVRLSGAHVRMFKHNDMNALEKLL
REVISQGHPKTHRPWKKILVIVEGLYSMEGDMVKLPTLIELKKRYKFNLFVDEAHSVGAL
GPHGRGVCDYFNINPREVDILMGTFTKSFGAAGGYIAANKPIIDSIRQHGHLGTYAESVA
PPVLMQVIASMASIMGVAPPVHSPSPSRGAVAKIPQDDGYQHPGPISPAILPSWLSLPPA
LASGVEGQDRIRRLAFNSRYLTVGLHLLGFITYGHPFSPVVPLLLFHPGKMLLFHRMMLS
RKTPICTVVVAYPATDLVTSRVRFCVSAAHTKEDIDTVLVACDEIGDWLSLKQGIPKSER
LPVKEIMERATELSVDILR
Download sequence
Identical sequences D8Q4G1
jgi|Schco1|82237|estExt_fgenesh1_pm.C_50136 XP_003031688.1.72525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]