SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Schco1|85464|estExt_fgenesh1_kg.C_60197 from Schizophyllum commune

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Schco1|85464|estExt_fgenesh1_kg.C_60197
Domain Number 1 Region: 333-564
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000000179
Family Tropomyosin 0.0011
Further Details:      
 
Domain Number 2 Region: 186-363
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000172
Family Tropomyosin 0.0012
Further Details:      
 
Weak hits

Sequence:  jgi|Schco1|85464|estExt_fgenesh1_kg.C_60197
Domain Number - Region: 74-222
Classification Level Classification E-value
Superfamily Tropomyosin 0.00157
Family Tropomyosin 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Schco1|85464|estExt_fgenesh1_kg.C_60197
Sequence length 653
Sequence
MLSPVAFVEPDRWSDSDRTDSDTPDLRVCTSLPPLYLKNPFHVSSFDTCDDDHDDLIDST
KSWPEDPRVCLRLVEQQLDEAERGMRLLAGALALAEAAVADADDVQQQADALLRDAEQRA
RAAQEYASREAARAKDADKRVAEVDKRVAEADRRAADERARADVAQMQARVAARKAEDAV
QQIREAEARAGQAERRTATAVAVARDAVGRASAAAAQVDELEARLRESDARAAESEARAR
KSDARATQGFERAVEAERRAKDIEDRLQGAEQSVQELSEKLREAEARAEAAEARAQAAEG
RAAEAESRTRVAEERAREVEALAGELEEQASRRVQKAEESAEDASTRAEIAAQYAREALE
RAEAATARAEEADAAHADAEERAQEAETRAQDAESHAQEAESRLHDAEARAQAAESQSNV
SNDTLRQLEERASAAEARAAKAEKRALTAERRYAEADERLQAAQKRAQTSDEGLRAAQKR
AQSAEARAFDAATREQNAVSAAAANGNREGTESQVRELQKRSESLARRAEGLENHAQALE
RYTRALEEQLVVVTVRNEALEKMVQPYQARAAGAYQGGYEPYANNAAISYAPQQAGALPY
ATNAYAAQPAGSQVSSNGGAQDASQWWAGSGARAGSGTAQQAVTAAAGQGYWG
Download sequence
Identical sequences D8Q6L3
jgi|Schco1|85464|estExt_fgenesh1_kg.C_60197 XP_003031160.1.72525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]