SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cflo_00741--XP_001121513.1_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_00741--XP_001121513.1_APIME
Domain Number 1 Region: 351-478
Classification Level Classification E-value
Superfamily Plus3-like 3.4e-45
Family Plus3 0.00000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cflo_00741--XP_001121513.1_APIME
Sequence length 702
Comment [mRNA] [translate_table: standard]
Sequence
MPKRKVQHQALIDSDSSGSASESGSDLDNDLLSLAKKKKGKSQDDSQSNEDNGSIKKDAK
HDSDTSDSDNNWNNKNTGKTKKKKGSSAKRSKRKVTKSSSEESASEKEPAKQLSEPEEGE
VSDSDVSVSDSSQEEFNDGYDDKLMGDAEDQARLAQMTEKEREQEIFKRIEQREIMKTRF
EIEKKLRMAKKQELRKQKESKKKEKGGEEKQKLDRAPDPKERSKDRKKTIEEKQDKKFHA
MSLLKARREEKKEREEKEKQRIEQQQQQSKDIEEEDLENDHKGGNKTKLKASDIYSDDSG
SSDSAEEEEETKPASQRRSSSSESRDSDSDNDKKSITSNKAKPKKPVYISTKEDLNKIRL
SRHKMERFVHLPFFDRVVQGCFVRIGIGNNNGKPVYRVAEISGVCETGKIYQLGGTRTNK
GLKLRHGAQERVFRLEFVSNQEFTDSEFFKWKETCAVQGISVPTFDEVEQKLKDINEALL
YEYKEEDIEKIVREKERFKQTPYNYAMKKAQLMRERDAANCRGDDETASRLNQELSELEE
RASELDKMRTATISSISYINDRNRKKNVEEAEKAIMEELKANKGKKIDDPFTRRSTKPRM
VFKPEDESEVVSTVPINDKSSPHPTVDSVSTANDKENGQESKKKQSTEDLFNAHDFDITI
DLEVPIPSNPVSVLPKPINNIKDTGPRRSLNLEDYKKKRGLI
Download sequence
Identical sequences E2A1P9
Cflo_00741--XP_001121513.1_APIME XP_019885561.1.72520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]