SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cflo_03528--XP_395730.2_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_03528--XP_395730.2_APIME
Domain Number 1 Region: 316-373
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 9.68e-23
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00012
Further Details:      
 
Domain Number 2 Region: 5-49
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000000000706
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00057
Further Details:      
 
Domain Number 3 Region: 273-307
Classification Level Classification E-value
Superfamily ARM repeat 0.0000662
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cflo_03528--XP_395730.2_APIME
Sequence length 373
Comment [mRNA] [translate_table: standard]
Sequence
MALSQTSVLKLYNTVIEDVIAGVRESFIDEGVDEQVLQELKQIWETKLMASKAVELNPDP
PEPQVPQINTHKAVSVNKANVGNHFVQPSAGNTVPQTQPQQSQQQTQQAQSQQQQPAQSQ
QHTHPTGTSLQQQQPQQHSTTPVQQVVTAPAAVLDRQVPIQITLPPQAGIPDGPQRILSI
QVPASALQGNQLHTILTGPVISAAMGLPANLASTLLQQHVNSTLQGQATLAPLQVNQPLQ
VVTQSTNSVVTQRPPQNQQQNNINQLDGGVGDSTDDDDEEEEDDNDDDDEDLDEKEEEEN
DEAAAREEEPLNSEDDVTDDDPADLFDTDNVVVCQYDKITRSRNKWKFYLKDGIMNLSGK
DYVFQKANGDAEW
Download sequence
Identical sequences E2AFV2
Cflo_03528--XP_395730.2_APIME XP_011257389.1.72520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]