SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cflo_04347--XP_001121740.1_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_04347--XP_001121740.1_APIME
Domain Number 1 Region: 1-234
Classification Level Classification E-value
Superfamily CutC-like 6.67e-68
Family CutC-like 0.00000475
Further Details:      
 
Domain Number 2 Region: 1460-1629
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.19e-26
Family Allantoicase repeat 0.00055
Further Details:      
 
Domain Number 3 Region: 1033-1219
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.25e-22
Family Allantoicase repeat 0.0015
Further Details:      
 
Domain Number 4 Region: 575-621,646-715
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.23e-21
Family Allantoicase repeat 0.0013
Further Details:      
 
Domain Number 5 Region: 1228-1398
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.08e-21
Family Allantoicase repeat 0.001
Further Details:      
 
Domain Number 6 Region: 884-1028
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.93e-21
Family Allantoicase repeat 0.0027
Further Details:      
 
Domain Number 7 Region: 248-390
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.38e-20
Family Allantoicase repeat 0.0011
Further Details:      
 
Domain Number 8 Region: 722-870
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.8e-16
Family Allantoicase repeat 0.0044
Further Details:      
 
Domain Number 9 Region: 402-549
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000119
Family Allantoicase repeat 0.0048
Further Details:      
 
Domain Number 10 Region: 1398-1452
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000808
Family Allantoicase repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Cflo_04347--XP_001121740.1_APIME
Sequence length 1631
Comment [mRNA] [translate_table: standard]
Sequence
MEICIDSLESARNAIEGGANRLEICSALSEGGLTPSPGLLKQIRNFTTIPLYVMIRIRGG
DFVYTTEEIDAMLHDLMILKDHQADGFVFGALTSDCEIDTVACEKIISAAHPLPVTFSRA
FDLMVDPVQSMQVLADLGFQRILTSGQRNSALEGLELIKTLVQKAQKLIIMPGAGITKDN
IRKIMESGAKEFHASAKRRKMVIYANRVILGSNENDFINVTDKELVKELVDIIRNETEPK
KQKSKVNGYEIMDAWISRKKQIFYEHDFVIIKLATRAEIHFICVDTALLIDNFAPEFSVQ
AGKLLLDPDIPQRKHNLNNSANNEDWECITQYNSESWLQIIPRQPLNPGYSSLSKKYFMI
PSKGEEYSHVRLNVFSDGGISRLRVYGKVTKPIFIPPALNMQIDLVSKIYGGKCISYSSC
CNNKHPNNLIKPSESINDEDGWQTVRRLIRFPKDFSNSATNLFNYFVDETLGEEWAVFQL
SKKYNSIIDSIILDTSFCVGKEPYVVQVQGITEDVCLNDTTNINNKLWQNIIPCTIVNVG
TKQLILTQNQTKNMAYVTEPDIDIENMPCRLPQDVWITRRKRVQNCDFVIIQLAVRAEIC
FICVDTANLFNNAALKFSVQATNLSIGILILNKKFPINMDRKMLPEEIIAQKSLLKEEQK
TWPYLISRQPLNPGYPSMNKKLFMIPSTGQEYTHLRLNIYPDGGISRLRVYGKVLRPTLM
PPPWNSCIDLVSKIYGGKCIAHSNCYNNSHPNNLITPMFSQDGWQTARSLIRSIEGFPHN
DSSFNFNQIIGEEWAIFQLGYCGKIVSIELDTTGFKGDSPYAVQVQGLREGATLNVLNEN
SINNASWQDIIPYTLVNEGSEQEITVQDQNMNMAYEVEPNIKCSHPDAWLTRRKRRNWKP
DFTIIQLAARAEIYFISVDTIYLTGNIPVQFSVQASQLLTTDVDTLEEYQDRFNRRGRPI
TNVEPHIRHLYSETWPYLISWQTLNSGYPSMSKKFFMIPSTGQDYTHLRLNIFPDGGISR
LSVYGKVLRPIHMPSQNWLIDLVSNIYGGNCIAYSSCYNNTHPNNMIKPGASLAMQDGWQ
TARSRFRIDDFAQPFNFNQFGEEWAIFQLGYSGKIASIKFEICSQWDKPYVVRVQGLREG
VTLNILNENDINNPPWQNIIPYTFRWPLLISWQPLNPGYPSMNKKFFIIPSTGQDYTHLK
LNIYPDGGISRLRVYGKVLGSIPVSPDRESTIDLVSKIYGGNCIAYSSCYNNTHPNNLIK
PTYSISKKDGWQTMRNFMRSTAGFPRPPIRTRFNQIIGEEWAIFQLGYNGKITAILINTV
GFKGNSPYIVRVQGLREGIIISDRTDICNKPWLDIVPFTIVNEGSSQQLIIGNEHQNIRM
AYVKLTIKPDGCVSRFREWPYLISQQPLDPGYSSKNKKFFKISSIGRDCTHLRLNIYPDG
GISRLRVYGKVEPNPIRSSPQNPLIDLVSQIYGGNCIAYSSSYNNTHPNNLIKPSKSINI
KDGWQTARSLIRSTEDFSDNPDISDFNKIIGEEWAIFQLGYSGKIVNIMLDTTCYEGDSP
YVVRVQGLTKIDDTTDINNKPWQNIIPYTLVNEGSKQEITVQDQNMKMAYVKLSIKPDGC
ISRFRVFGYKF
Download sequence
Identical sequences E2A257
Cflo_04347--XP_001121740.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]