SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cflo_05284--XP_001120293.1_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_05284--XP_001120293.1_APIME
Domain Number 1 Region: 50-151
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 4.29e-23
Family Insect phospholipase A2 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cflo_05284--XP_001120293.1_APIME
Sequence length 236
Comment [mRNA] [translate_table: standard]
Sequence
MTRIRAINLIAFCTFVFFVDKNSVTEAHSLKDYLKGLRSLSQLKNLRHGILPGTLWCGLG
NIARNDSELGLYSEIDTCCREHDGCEDSISSKATRYRLYNKYFCRSSLCECDLQFYDCLM
RIRGLYAAAVGKVYFKKCNQCFRTYYDPEECIKEGLDVTEEMDRKGRRVFCAKFDQNPKW
GQRHNVTSPHRSIYVDELLNWPDDEVAQYVPQSYPPNDRRYPVEEDDAMRDIEDNY
Download sequence
Identical sequences E2AST4
Cflo_05284--XP_001120293.1_APIME XP_011263397.1.72520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]