SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cflo_07683--XP_396603.3_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_07683--XP_396603.3_APIME
Domain Number 1 Region: 500-788
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.88e-72
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 179-241
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000169
Family LIM domain 0.0033
Further Details:      
 
Domain Number 3 Region: 94-157
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 0.000000000000711
Family Insect phospholipase A2 0.0036
Further Details:      
 
Domain Number 4 Region: 236-268
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000727
Family LIM domain 0.0067
Further Details:      
 
Domain Number 5 Region: 366-412
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000118
Family PDZ domain 0.023
Further Details:      
 
Weak hits

Sequence:  Cflo_07683--XP_396603.3_APIME
Domain Number - Region: 149-178
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000114
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cflo_07683--XP_396603.3_APIME
Sequence length 1316
Comment [mRNA] [translate_table: standard]
Sequence
MIAILFSILPILWLQKIEASVLVADTTMSRMVELNADAPFCALYSDRGTIQRMVLGADPR
KVRQISSNLVADLEETCKASQNKGKNQGPGSGLIYPGTKWCGPGNVTVGYNDLGQHSAED
ACCREHDHCPYTIAPQECIHDLGGEESGGTLICAGCLNAIDEDEFIQALNQEWHIDCFRC
SACDIGLSSWYFEKDGLLFCKDDYWAAYGEACQGCGQIITGPVMLAGDHKFHPECFACTS
CGAFIGDGESYALVERSKLYCGVCYKRQMQPLNRTANYPFARKPHSIRLVEIPPSTTDPD
KQRGIKLTLDTAPSPRSCGALLRISELMRNVRGKISKLLASVMEVLFRLCCHFSNHRLNM
SSDLISLHIGDRILEINGTPVKDQPVENIENLIQYSDTVLQLTIEHDPDAVSRRPTFCSP
SSTMLTCVGNPRTSPENKERLFKRRDEGYMSGARSRQLRRTRDPMHKERSSSMSRLLDGS
SPTNPTYDLSRTRSFRVEPKNQRIFRASDLVKGELLGKGFFGQVFKVTHRDTDEVMVLKE
LYRVDEDAQKNFLKEVAVLRSLHHNNVLRFIGVLYKDKKLHLVTEYIAGGTLRALLHDTN
EPLPWEQRTSFAKDIAAGMAYLHSMNIIHRDLNSHNCLVREDKTVVVADFGLARIIQNGS
SPDNRKYNRHSDGEVKTSKKERKKRYTVVGNPYWMAPEMMKGNKYDEKVDIFSFGIVVCE
IIGRVQADPDYLPRSSDFGLNQNVFKEKFCSNCPETFYMIAFLCCDLNPDKRPPFEVMEV
WLEGLAMHLSVGAELPANLDFDIRNYKGPSPSSSESTTPETLAPQLKPIKEGQVHQEKKR
SSGCDDSTLEREIQPVPISNTLLVPEVVSPRNRYTRQNSKSNDNSNNVGRYSRQNSKSKD
FDKEKSIVISSDSSSFSGRYLRNNNAKLKDTSPDIPNIYAYSKIDTSEHNVTRVPNIEKI
KYVGSASQCTVSDASDYIIDSKGSYKISNNLKHKSTEKSNDTSGCKVKSENKFKIPDTAS
SVGSYLRQIGKSIGAIEKENKAINNRNDVNSGDINPKKVVGEGTKPCSGSYLRRTKISPT
KETTKNAFSNKEIDKVDGVSSLQKSVQSKVPPNQENVIEKEDVKDRLSKQENNVSDVGSI
LSRQGSPTVLDCTSKYKDYSLFDTYMKDDFRKNDSFKKLYSSSLYHTDSLYSNSSVSKRD
NLITPNRQNASDDGNRPVVAESMSDDTKTPMMTSSLYGSDLKNCLADYTRCYKGIDVCRQ
DSFGSDSALGTMKSDFFADIDFAQMRDSRHTPDLCHTSERCCTPNRPTTPIESTAL
Download sequence
Identical sequences E2AJQ1
Cflo_07683--XP_396603.3_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]