SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cflo_14914--XP_001600107.1_NASVI from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Cflo_14914--XP_001600107.1_NASVI
Domain Number - Region: 5-50
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 0.00322
Family Insect phospholipase A2 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cflo_14914--XP_001600107.1_NASVI
Sequence length 90
Comment [mRNA] [translate_table: standard]
Sequence
EFHILGYQFCGPGTRFLKRLARGDRGINPLDAACREHDIAYSRSNDLTERHAADRILSEK
ARNRIGVRDSTLGERAAATAVWAAMKVKTK
Download sequence
Identical sequences E2A9E3
Cflo_14914--XP_001600107.1_NASVI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]