SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cflo_00406--XP_392413.2_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_00406--XP_392413.2_APIME
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 5.67e-32
Family Deoxycytidylate deaminase-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cflo_00406--XP_392413.2_APIME
Sequence length 168
Comment [mRNA] [translate_table: standard]
Sequence
MAIAFLSAKRSKDPCTQVGACIVNNDKRIVGIGYNGMPMGCDDDKFPWGKGSHNRDLDTK
YLYVCHAEINAVLNKNSSDVKDCTMYVGLFPCNECAKVVIQSGIKTIIYMSDKNGHKVET
IAAKKMFDAAGIKYRQYIPKNQKIEINFSDINWNQMSQLPQTPIKQED
Download sequence
Identical sequences E2ANZ7
Cflo_00406--XP_392413.2_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]