SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cflo_08031--XP_624402.1_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_08031--XP_624402.1_APIME
Domain Number 1 Region: 1586-1793
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000981
Family Tropomyosin 0.0048
Further Details:      
 
Domain Number 2 Region: 1386-1622
Classification Level Classification E-value
Superfamily Tropomyosin 0.000085
Family Tropomyosin 0.0022
Further Details:      
 
Domain Number 3 Region: 31-187
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0000994
Family HBL-like 0.046
Further Details:      
 
Weak hits

Sequence:  Cflo_08031--XP_624402.1_APIME
Domain Number - Region: 420-532
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00178
Family Myosin rod fragments 0.0055
Further Details:      
 
Domain Number - Region: 1080-1314
Classification Level Classification E-value
Superfamily Tropomyosin 0.0229
Family Tropomyosin 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Cflo_08031--XP_624402.1_APIME
Sequence length 1935
Comment [mRNA] [translate_table: standard]
Sequence
MDSARSGGAIEEQGSDEDLSPDALVRQNYELRHRLEQEAASYKRRLDTYRQAQQHQAALV
SRLQAKVLQYKQRCSELENQMAETVPCDTTKPTAATAAVSSTSALEAAHQTLRDIREEQI
HDLDTALQKLGEERRKCEELLQLNSSLKDQLEESHQTNEALTTDLQKLSNDWDILREELA
IKEDEWKEEEQAFNEYYISEHNRLLNLWRDVVSVKRLFAEMKSATERDLSKLRNEITSSS
NEMTSACNSISFTMKLQATAVQSTPSQRIQQEEEEQAVTVLKTEIAALKQQHAADQHEIR
TKDDRIDQFIREIRNLEERCGISEAAVTQTARMQEDIEVLESALRDIAHAVIQDAESRDV
DVKQAPSHIHLSSGGQISQRSPKRSARNIAIPALAESTISAVRAALQKYQLTIRELQIKL
QTNKEQLLTMRKQWDTAETNAQTLNTKVAELISQLDSCRSQCTQLNQEKEMLQKSLDTVK
LEKNALDKNKMELNSMLEALKNNYEKLQKTNNKLQKLCDNLEDEKLYLQNELSRVSEDAD
LKELNLRSEEDRCSKMREELLTLREDLNKAYLAKDMLEQQKLETDGLISQIEKNKGDLEL
ELERILLEKSDVQEILIKLEAMCSNHEQDKQKLQEELKKMTDEKNKLASQCIDQQGDLNS
LRKELLQAEQTRLDIESEKVTLNEKIKFLEIEKEKVEIELGQVSRERSDLSNQLSVLARK
KETLNEELMRLRQRLEQSNEMNARINRNLKDLVKDNEEKQVLLETNEKEIQRMQEQLASM
RTEKEILEGVLFDTQTNLEATHVKKTQLEKEQKETLIKQESLKGQVTRLTKELENSEKRA
QDMKQSLTQQSGDQMAEFQQIISNMKKQSEDNMKKMTDEKEQVRISLEKRLQQSVLQLEG
EKNEEINQLQQRIEELQQHVENLCKQHEEALLRAENDKQQALLIAHHDQQALIEKINAIM
RELEEEKNTLERVKREAATRAEQERNNTNQLRDELNRLRTKLDETKLKANEEKLKLDLKI
EELWKERESTQREVEELQVQLHMTEDKVDGLQNQLHDTIRKLKDADNINETLRKELVDSR
RQLADTTYEKEKYNNSNKELRERVKQIETERREQGRILEESYQKIATLEDVKAAMDIERT
RLQAQVRDLERDALQLQQQLRFTQDELQKCHENNSQAQNEEKELQARLANEIEERERIQL
QLHQVKKQVVDLDNSLEVTRQELGKLRTRADEEDERWRAREQELLVRLEDSRCRERKLED
QKHNLEVCLADATQQLQELKARLGGSEGRVRALDAQLSQLETAKKEVEQKLSSVGSTLRR
IAGIQMDGSVNMPFKLMSPSRRWSPARVQDHGDTGRDIILDVDPEAIRKGVRSLMQQVAQ
IERERDDYKTELCSLKKQLKESQENQSNTDIKANNLLANIRTLQEEKKSLEAKLTQKQTS
YQAQLNALQQKTKECEQLCEKLSMLELKISTESEEKSQYEDKFEKMKHELNRLETEKRSL
QKDVRHSESRATEMELHRMSLDGDFQRLQMMLQEKEAHIQKLQDRFDTQSRTMTNLEERC
ASLKSTIEQLKLALEKASATESELKSEMNLLQHNIIEITASSQSNNEKLKQLQKQLSNTE
NERRILSERLETVQQTLSDLKHTNQSLIDQNARLQNELANNEVQRSALESQLRLSTWPPE
GSTTKDEGLLRQLQTVQRERSEMRGKVDALNDKVKLLEADKRNLERQIAAGKTSVIRSKS
YERPEKAHIELLGTSYSLDNLEHENRELRLKIRKLETQLAEKEAELIRIKSTYIHSSHSL
LDTSRDRSGELERIRAAQLQAEKLLEAREQSHRQQVSRLENQIQLLREQLNQEIKRRQLY
VLRSSRAGREMQQLRQALGDSLRTVAQDPSLDAVLLEHEARKLDSTLTSTTSLPPSLALP
APPSSHRSGTPSQLK
Download sequence
Identical sequences E2B1W1
Cflo_08031--XP_624402.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]