SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cflo_14311--XP_394148.3_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_14311--XP_394148.3_APIME
Domain Number 1 Region: 125-213,398-486
Classification Level Classification E-value
Superfamily Fibronectin type III 1.76e-18
Family Fibronectin type III 0.005
Further Details:      
 
Domain Number 2 Region: 517-693
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000195
Family Fibronectin type III 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cflo_14311--XP_394148.3_APIME
Sequence length 734
Comment [mRNA] [translate_table: standard]
Sequence
MQITFGIILCILCILLKGLVLTKAIITFVPKDYTPSNSLQEESDSICPDLNSTQDILMFE
KNDHRNLKSDRSYSDSMTVRKKREVNVVPLASNSTILKSIENSLSKPTSLRAFVEFDRKF
AKKINDIFVTLRWNQPEFIDEIIQGYTVQCFFIEDLKDIQICDDKNITTTKLEHTVHNLT
SNMTYYFRVRAHSKIVAGPYTDLINVSTTHENPIPKLLVTSGKGIYILDVDFTITNFVTI
LYHVSYHHTSRHSYRMIKYHLDEKINLIVPIKTFCLYRYKPDLFRDMKIDNMNNEGLLIC
WLSKSYIIVTDVNISMCNAILHTKYLSDIRFQSITIDKTNIYILAYKVHTYNAKYIYVLK
KKYASLTSINATKNVEKIISYTNESYQIYAIDKSLQPYPPMRCLTPHEKVYNFENVNATA
NNILVTLQKPIVKRGCKKYNLPTTIYTISVSCLDNNLNKFVKFNVQTFKRVYRIWNLTPF
TEYKLKFTLSNFYFDQLPINPFDSNVIQIKTNSGKLNAPENISVLALTPTIAVVHWMPLK
KENCVAVTYEVHWKSDTLVNGMQQKGKQFIKMPKPTADGRFFTKINLSLPVQDYLIYVRV
YPNNFSDFYNESLGKIDHIYSEPNDITLSKVEINSIDISWIPNIHLTVSPTLEYKENATE
KWQTMNYVKMNYNKQIIYHIGNLQSKTLYKFRLVLRYPEYEENFIWPADERFMFSTLGKQ
TKISIHYNNIAWIY
Download sequence
Identical sequences E2AM97
Cflo_14311--XP_394148.3_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]