SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G003992_P02 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GRMZM2G003992_P02
Domain Number - Region: 66-130
Classification Level Classification E-value
Superfamily Tropomyosin 0.00371
Family Tropomyosin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G003992_P02   Gene: GRMZM2G003992   Transcript: GRMZM2G003992_T02
Sequence length 172
Comment seq=translation; coord=2:186341209..186342404:-1; parent_transcript=GRMZM2G003992_T02; parent_gene=GRMZM2G003992
Sequence
MLELKLEEATMLINERDSEILELDALSHVQPQNTVACNNYPLSLQSDVDRLFLEKMEAEI
QCFILTRASQDWKLLTMDQFALNEAQKSLLSDHKSLETKLRHAENRAMMLEEMVDKLESQ
CKALSETSEVLKLQAGASRASLFCSIQFVLLCIAIGTLLVRFLSSSPEIVPT
Download sequence
Identical sequences GRMZM2G003992_P02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]