SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G161610_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G161610_P01
Domain Number 1 Region: 165-248
Classification Level Classification E-value
Superfamily POZ domain 1.49e-25
Family BTB/POZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 16-145
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000000119
Family MATH domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G161610_P01   Gene: GRMZM2G161610   Transcript: GRMZM2G161610_T01
Sequence length 274
Comment seq=translation; coord=6:93724449..93726731:-1; parent_transcript=GRMZM2G161610_T01; parent_gene=GRMZM2G161610
Sequence
MEHDGTNLLAVNEVLRSVQLLKIDGYCATATMSELEFIKSRWCTNGHEWEVRFHPTYKWN
GRWVAVKLILISEPLRDKLRVSLSCRMRPNNFQRDLGASYEQSLSHIFPSDSKCSPVLLL
MSRAELGSSDYLVEDSLTVECTLTELRGFDASVKDPPLPVPQPQPLRSDLHQHLGELLQS
KDGADVTFRVSGESFAAHRVILAARSPVFKAEFFGGMKERSSAYVEIRDMDAAVFRSMLH
FIYTDMVPELDGAQDQEPEAAAGGGHGSAPTRSC
Download sequence
Identical sequences B4FNH2
GRMZM2G161610_T01|PACid:20824566 GRMZM2G161610_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]