SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G368023_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G368023_P01
Domain Number 1 Region: 160-249
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.05e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.00064
Further Details:      
 
Domain Number 2 Region: 59-117,167-190
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000394
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G368023_P01   Gene: GRMZM2G368023   Transcript: GRMZM2G368023_T01
Sequence length 334
Comment seq=translation; coord=4:143603545..143607024:1; parent_transcript=GRMZM2G368023_T01; parent_gene=GRMZM2G368023
Sequence
MKLTKERLLDRRARSFLMAMMCERSLAELQGVSSQQTTEGTGVFGRFRFLNQRVSSQSED
SLSCHRIDLRTSTIKIDADENDLRFCFRIISPVKAYTLQAESGADQKDWIQKITGVIASL
LNSPFPQQLSYGNVAAESNRSTSSVDSLSIEDNKSSEGHDDIFNLLRNIPGNDSCAECRS
PDPDWASLNLGILICIECSGAHRNLGVHISKVRSLRLDVKVWEPVIMDLFHALGNDYANS
IWEALLPKEDQGRGSWVSCHPSLFHGSTCKENEFHGLSIIDKYNSVGATFPEIPIAEIPM
AATQIHHIAPSEVMAELLLASRPEDEAGPSRSAV
Download sequence
Identical sequences GRMZM2G368023_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]