SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G466270_P02 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G466270_P02
Domain Number 1 Region: 1-36
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000168
Family PHD domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G466270_P02   Gene: GRMZM2G466270   Transcript: GRMZM2G466270_T02
Sequence length 78
Comment seq=translation; coord=5:64751043..64754999:1; parent_transcript=GRMZM2G466270_T02; parent_gene=GRMZM2G466270
Sequence
MIACDQCDEWYHFDCINLLGPPPESFFCPACHPNNGEESVSLARSEDDEDRSSTGAGAHT
PPDRVVERDLIKLLSCHS
Download sequence
Identical sequences GRMZM2G466270_T02|PACid:20878514 GRMZM2G466270_P02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]