SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AC193767.3_FGP003 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC193767.3_FGP003
Domain Number 1 Region: 113-218
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.09e-20
Family B3 DNA binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AC193767.3_FGP003   Gene: AC193767.3_FG003   Transcript: AC193767.3_FGT003
Sequence length 366
Comment seq=translation; coord=10:148838873..148840060:1; parent_transcript=AC193767.3_FGT003; parent_gene=AC193767.3_FG003
Sequence
MATEPALPQGHGDGDSIVDRDVWLACAVPFSRVPTVGAEVYYFPDGHAEQHLLAPLPASH
RFPCTCTVTDVSLGAEDRTDEVFAKISLRPGPAAASRPEPGPGPGSSNSTRQGLSYFVNE
LLHRDTSTSGMFCIPRYCTEHIFPKLDLNANPPEQDLVMRDTRGKPWQFHHIYVVKIRQH
RLTAGWSEFVDAKLLVAGDTIVFMRHPNGDLILGLRRKATRTSWRPRASPPWAGPSRSPT
SRDRPPWSSSSRTARWIARSPPAGNEARRLEDENKQRSVWVDGHVVKANRQNIWRMLEIH
WWGDSPASASPPSRAMSRFVNVWQVQRVAWFLPRPYYWRVRKKPGPGHEHDIGGATNSCN
AKPLSC
Download sequence
Identical sequences K7TTV6
AC193767.3_FGT003|PACid:20874468 AC193767.3_FGP003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]