SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AC200117.3_FGP004 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC200117.3_FGP004
Domain Number 1 Region: 178-250
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000628
Family B3 DNA binding domain 0.0086
Further Details:      
 
Weak hits

Sequence:  AC200117.3_FGP004
Domain Number - Region: 28-98
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 0.000283
Family Metal cation-transporting ATPase, ATP-binding domain N 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AC200117.3_FGP004   Gene: AC200117.3_FG004   Transcript: AC200117.3_FGT004
Sequence length 252
Comment seq=translation; coord=4:246480241..246481182:1; parent_transcript=AC200117.3_FGT004; parent_gene=AC200117.3_FG004
Sequence
MVHSRRSARARDDSAKLHAAAQEVHFLPFNFNPIDKCMALTACIADGRCHRVSNKGAPEQ
IMTLRKCQEEDVTNKVDATIDKHAERGLAVARHARPDVATSSKKKKKEERRNSGGANKSR
NRVPSSITDVQHERLKALGATKPPRFMIGKSHMASDVDPKQARLLFSSKRKSLSQVTLVL
TRTEMGLVRDRAWLLVTAFDRDGRSYHLTCKYLESNSGYRFIAGWKAYVQDNGLGAAMRV
DLWWFRSRKLHN
Download sequence
Identical sequences AC200117.3_FGP004 AC200117.3_FGT004|PACid:20856591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]