SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AC205703.4_FGP008 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC205703.4_FGP008
Domain Number 1 Region: 2-80
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000104
Family B3 DNA binding domain 0.0027
Further Details:      
 
Domain Number 2 Region: 651-712
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000255
Family B3 DNA binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AC205703.4_FGP008   Gene: AC205703.4_FG008   Transcript: AC205703.4_FGT008
Sequence length 717
Comment seq=translation; coord=5:180417992..180420743:-1; parent_transcript=AC205703.4_FGT008; parent_gene=AC205703.4_FG008
Sequence
VIPRIVAPRLEYLTNQLVYLKDSKGKCLKVLVSKVVDSLAFDQGWDVFVSNHLIKWGEFL
LFEYIAERTFSVRVFGTDSCERLDFNPESTNKGETKKQAWSNMPPDDLVVTDGISENSGY
YVSGECPRTKVPQTCHVTCNTKKDPKRVERVVGSGPVAQDISGNLIGPQCKTKGTPLCSK
GKTVIMIIDSEDSEPSAHEKEDTMKLATSGPDSDISLVAVNTNEDPIRAQSGIGNGPSAV
LADEKGNFPEIECGTKCISATCSEVKTVSQIISATALLDLHDSDENLGRKQRTNAIPLDS
RTTAEDYHNYSKMIIIQNFNRKYEAPGGFRCLEKWRKDVVNNQTALDCTAPIKHENPQKT
DGMLVDGYGLIELNPVDEYICSEGNHECVQPVFTMPIKEPSSADRVIDCGRDGTEINYSI
NEKDGEVDTKCIQTRPYDVKASVLFHSKEEEFIAVVLLFYLKQKENKPMGSIVHSQSNNV
WLSANPVVAGKYAALGLNPSRSEGSCAFIESMLTGSIEKTSSPDEISKCKNSMMETAHNV
NGKGGGTTAQFETKMDQAEPARSGVRSKICNSVVPANESEHRSTKQEGRMSSNREVPESL
LPTKDEIPEPDHHSPPEINFQLCIPDTTQKWLDLSKSLSNAVRRQRRHDYDVIMLKDPKK
RLWPVVYHDSLLFVGFTAGWKHFVASNDLRAGDVCELVKEPDDGEPVYSVRMSDHKI
Download sequence
Identical sequences AC205703.4_FGP008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]