SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AC207755.3_FGP006 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC207755.3_FGP006
Domain Number 1 Region: 38-134
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.16e-27
Family B3 DNA binding domain 0.000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AC207755.3_FGP006   Gene: AC207755.3_FG006   Transcript: AC207755.3_FGT006
Sequence length 280
Comment seq=translation; coord=10:5597566..5598563:1; parent_transcript=AC207755.3_FGT006; parent_gene=AC207755.3_FG006
Sequence
MATHHLAQGHPQAWPWGMAMYTNLHYHHHQQQQYYEREHLFEKPLTPSDVGKLNRLVIPK
QHAERHFPLGGGDGNGNEKGLLLEFDDEAGRPWRFRYSYWVSSQSYVLTKGWSRYVKEKR
LDAGDVVRFDRVRGAGVGAADRLFICCRRRGESAAAASAAATPTPPPVAPALNAGEQQQQ
QPWSPTVCYSTSGSSYPPSPASPYAYHIDTPHAGAGEADAKSSGGTPTTGTAPTRKLRLF
GVNLDCGPEPETETPTAPMYGYGYVHQSPYAAVPAVPSYW
Download sequence
Identical sequences GRMZM5G805685_T01|PACid:20875698 AC207755.3_FGP006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]