SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G001048_P02 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G001048_P02
Domain Number 1 Region: 98-195
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-16
Family B3 DNA binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G001048_P02   Gene: GRMZM2G001048   Transcript: GRMZM2G001048_T02
Sequence length 411
Comment seq=translation; coord=4:14693996..14697010:1; parent_transcript=GRMZM2G001048_T02; parent_gene=GRMZM2G001048
Sequence
MRGRKRQQVSASSAAALVKGRESTKQKEKEARKEKEAREAGREPAAKERQMRRKAGKEKE
TETGGEGKEPAKEKEVREEGKENDKHKEKAKTKANVCPQFFKVFFPEQSTERLRIPPMFN
QHLKEQQPTGAVSLRGPSGNRWQAALASESESEAAWCFDQGWKEFVTDHSLRLGHFLVFT
RDGPAQFSVAVFSSSGVIDPAALDARPTANGGAAVKLEDGEGVGVRGDVDAGGDTSSEVS
LLPAEEGDGGATGRRTGATSGGAGGASEMSLVLREEGRGVTGKRARATTSDLPADASAPK
KHSALAKKAGKRRPQAATSKDVSMIVHNPTFSLLDESKTFNKTQIRDKNVPRSGKFLLRT
TKAPVVISQRRRVTEEEKCLALRKAMEFKSKHPFTMQIMIESYVYVGFFMV
Download sequence
Identical sequences GRMZM2G001048_P02 GRMZM2G001048_T02|PACid:20860089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]