SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G006042_P02 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G006042_P02
Domain Number 1 Region: 144-276
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.02e-41
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 682-755
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000461
Family PB1 domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G006042_P02   Gene: GRMZM2G006042   Transcript: GRMZM2G006042_T02
Sequence length 813
Comment seq=translation; coord=10:13836938..13842930:-1; parent_transcript=GRMZM2G006042_T02; parent_gene=GRMZM2G006042
Sequence
MVAAAAAAGGGADAGCGGGGGGGGKDALFVELWKACAGPLSSVPLLGEKVYYFPQGHIEQ
VEASTNHLAEHQGTPLYNLPWKIPCKLMNMELKAEPDTDEVYAQLTLLPDKKQDENTSAR
VENEEAEEEVVPHVPPATSEGLRIHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSQ
HPPNQELVAKDLHGVEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFLRGENGE
LRVGVRRALRHQTTIPSSVISSHSMHLGVLATAWHAVNTGSMFTVYYKPRTSPAEFVVSR
ARYCESLKRNYSIGMRFRMRFEGEEAAEQRFTGTIVGICVSDPSGWADSKWRSLKVRWDE
ASSVPRPERVSPWQIEPAVSPSPVNPLPVRFKRSRSSVNASPSDVSTVNREVASKVMVES
QQNNLPRALHNQGRTQLTGRYRDSTDVKTAQDLTMWSSGTEQQRNNIAAQTKRCLEGWTQ
SRTPEGYNQLFSAFQPLKDAHNPLRPFPNKISGTRSSTWVTADARYPAQQANHNMLHGTL
SFMPHSSGFRMIQQNNLVTPEAANFTGKSAFTSLQGHVTDQCSTGWFGSIESNSHTDHAS
SSLIRSQPLVIGNDVQKTKGTSFKLFGIPLGSPEKSEPLVSPPSVAYDGKLQTSPTDNNE
PCSEATQNIQNKVQSSSTRSCKKVHKQGSALGRSIDLTKFACYDELIAELDQMFDFDGEL
KSPCRNWLVVYTDNEGDMMLVGDDPWNEFCDMVHKIFIYTREEVERMNPGALNARLEDCL
SDSLGRGLASKEPRSGPSTSAVDSENRANLSSQ
Download sequence
Identical sequences C0PE25 K0DFB6
NP_001169329.1.34533 GRMZM2G006042_T01|PACid:20874354 GRMZM2G006042_T02|PACid:20874355 GRMZM2G006042_P01 GRMZM2G006042_P02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]