SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G017187_P04 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G017187_P04
Domain Number 1 Region: 114-258
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.41e-45
Family B3 DNA binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G017187_P04   Gene: GRMZM2G017187   Transcript: GRMZM2G017187_T04
Sequence length 289
Comment seq=translation; coord=2:47925943..47929049:-1; parent_transcript=GRMZM2G017187_T04; parent_gene=GRMZM2G017187
Sequence
MAAAMDAPNPGAAAGPGMPSDALYQELWHACAGPLVTVPRQGERVYYFPQGHMEQLEASA
HHQQLDQYLPMFDLPPKILCRVVNVELRAEADSDEVYAQIMLQPEADQNELTSLDAEPQE
REKCTAHSFCKTLTASDTSTHGGFSVLRRHAEECLPQLDMSQNPPCQELVAKDLHGTEWH
FRHIFRGQPKRHLLTTGWSVFVSSKRLVSGDAFIFMRGENGELRVGVRRLMRQVNSMPSS
VISSHSMHLGVLATASHAISTGTLFSVFYKPRFDVVLLYLYICLQCTSY
Download sequence
Identical sequences GRMZM2G017187_P04

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]