SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G018485_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G018485_P01
Domain Number 1 Region: 84-175
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.44e-28
Family B3 DNA binding domain 0.0000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G018485_P01   Gene: GRMZM2G018485   Transcript: GRMZM2G018485_T01
Sequence length 404
Comment seq=translation; coord=10:134221928..134223700:-1; parent_transcript=GRMZM2G018485_T01; parent_gene=GRMZM2G018485
Sequence
MEFASSSSRFSKEEEEQEEEEDEEVSPREIPFMTAAATAGTGATSSSPSPSAAASASASS
SAAALRSSGGGGGGDDDMEVVEKEHMFDKVVTPSDVGKLNRLVIPKQHAEKYFPLDAAAN
EKGLLLSFEDRAGKLWRFRYSYWNSSQSYVMTKGWSRFVKEKRLDAGDTVSFCRGAADAA
RDRLFIDWRKRSADSSRHPHRMLPRLPLHMPPLASPYGYGPWGGGAGGFFVPPATLYEHH
RFRQALDFRNVSAAAAPARQLLFFGSAGMPPRASIPQQQQPPPPSLHSIMMVQPSPEATA
GLPMLLDSVPLVNSPTAAAKRVRLFGVNLDNPQPGSSAESSHDTNALSLRMPGWQRPGPL
RFFESTPQRGAAGAAAGAESSAASSPSSPSSSKREAHSSVDLDL
Download sequence
Identical sequences K7U5N4
GRMZM2G018485_T01|PACid:20872720 GRMZM2G018485_P01 XP_008663443.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]